BLASTX nr result
ID: Glycyrrhiza28_contig00039529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039529 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNB36855.1 hypothetical protein ACH54_09375 [Salmonella enterica... 181 2e-57 ETJ15637.1 hypothetical protein Q609_ECAC02436G0001, partial [Es... 184 2e-57 EJL13834.1 putative membrane protein [Shigella flexneri 6603-63] 183 5e-57 EIQ74725.1 putative membrane protein, partial [Shigella flexneri... 183 6e-57 WP_074153203.1 putative colanic acid polymerase WcaD [Escherichi... 184 7e-57 WP_074148293.1 putative colanic acid polymerase WcaD [Escherichi... 184 7e-57 EIQ21379.1 putative membrane protein [Shigella flexneri K-315] 184 7e-57 WP_029364620.1 colanic acid biosynthesis protein, partial [Esche... 184 9e-57 EYH86074.1 putative colanic acid biosynthesis protein, partial [... 181 1e-56 CDL48472.1 Colanic acid polymerase WcaD [Escherichia coli ISC41] 184 2e-56 CSN73974.1 putative colanic acid biosynthesis protein [Shigella ... 184 2e-56 EKW85041.1 putative colanic acid polymerase WcaD, partial [Esche... 184 2e-56 WP_072274367.1 putative colanic acid polymerase WcaD, partial [C... 183 2e-56 WP_074439559.1 putative colanic acid polymerase WcaD, partial [C... 182 3e-56 WP_073828094.1 putative colanic acid polymerase WcaD [Shigella b... 183 3e-56 WP_000107780.1 hypothetical protein, partial [Shigella flexneri]... 183 3e-56 WP_073691140.1 putative colanic acid polymerase WcaD, partial [S... 184 4e-56 EST77385.1 putative colanic acid biosynthesis protein, partial [... 184 4e-56 ETJ28131.1 hypothetical protein Q609_ECAC00160G0007, partial [Es... 184 5e-56 WP_040080041.1 putative colanic acid polymerase WcaD, partial [E... 184 6e-56 >KNB36855.1 hypothetical protein ACH54_09375 [Salmonella enterica subsp. enterica serovar Infantis] Length = 137 Score = 181 bits (460), Expect = 2e-57 Identities = 89/94 (94%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPK+DAMILAGI+LSGSFS Sbjct: 13 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKSDAMILAGIILSGSFS 72 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNK+AIKKKLPLA++SL Sbjct: 73 GVMTFILFYLLEWAFQYLNKDAIKKKLPLALVSL 106 >ETJ15637.1 hypothetical protein Q609_ECAC02436G0001, partial [Escherichia coli DORA_A_5_14_21] Length = 227 Score = 184 bits (468), Expect = 2e-57 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 11 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 70 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 71 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 104 >EJL13834.1 putative membrane protein [Shigella flexneri 6603-63] Length = 219 Score = 183 bits (465), Expect = 5e-57 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDA+ILAGI+LSGSFS Sbjct: 102 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDALILAGIILSGSFS 161 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 162 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 195 >EIQ74725.1 putative membrane protein, partial [Shigella flexneri 1235-66] Length = 225 Score = 183 bits (465), Expect = 6e-57 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDA+ILAGI+LSGSFS Sbjct: 108 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDALILAGIILSGSFS 167 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 168 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 201 >WP_074153203.1 putative colanic acid polymerase WcaD [Escherichia coli] Length = 261 Score = 184 bits (468), Expect = 7e-57 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 13 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 72 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 73 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 106 >WP_074148293.1 putative colanic acid polymerase WcaD [Escherichia coli] Length = 261 Score = 184 bits (468), Expect = 7e-57 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 13 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 72 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 73 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 106 >EIQ21379.1 putative membrane protein [Shigella flexneri K-315] Length = 261 Score = 184 bits (468), Expect = 7e-57 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 13 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 72 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 73 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 106 >WP_029364620.1 colanic acid biosynthesis protein, partial [Escherichia coli] Length = 272 Score = 184 bits (468), Expect = 9e-57 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >EYH86074.1 putative colanic acid biosynthesis protein, partial [Salmonella enterica subsp. enterica serovar Heidelberg str. N4403] Length = 189 Score = 181 bits (460), Expect = 1e-56 Identities = 89/94 (94%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPK+DAMILAGI+LSGSFS Sbjct: 33 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKSDAMILAGIILSGSFS 92 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNK+AIKKKLPLA++SL Sbjct: 93 GVMTFILFYLLEWAFQYLNKDAIKKKLPLALVSL 126 >CDL48472.1 Colanic acid polymerase WcaD [Escherichia coli ISC41] Length = 301 Score = 184 bits (468), Expect = 2e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 99 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 158 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 159 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 192 >CSN73974.1 putative colanic acid biosynthesis protein [Shigella sonnei] CSV27865.1 putative colanic acid biosynthesis protein [Shigella sonnei] CSR59534.1 putative colanic acid biosynthesis protein [Shigella sonnei] SIW62508.1 putative colanic acid biosynthesis protein [Shigella sonnei] SIX94544.1 putative colanic acid biosynthesis protein [Shigella sonnei] SIX69495.1 putative colanic acid biosynthesis protein [Shigella sonnei] SIW66187.1 putative colanic acid biosynthesis protein [Shigella sonnei] SIW78031.1 putative colanic acid biosynthesis protein [Shigella sonnei] SIW84222.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJE30459.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC81217.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJE06122.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC98428.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD04865.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJE09121.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC71658.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD81376.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC65930.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC56544.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC82654.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC88530.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJE33858.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD18386.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJE04472.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC65452.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJE03790.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD44013.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD80101.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD92132.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD81072.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC78595.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD15673.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC70580.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC95742.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJC87737.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD75176.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD08781.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD63668.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJD97406.1 putative colanic acid biosynthesis protein [Shigella sonnei] SJL89248.1 putative colanic acid biosynthesis protein [Shigella sonnei] Length = 302 Score = 184 bits (468), Expect = 2e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >EKW85041.1 putative colanic acid polymerase WcaD, partial [Escherichia coli 97.1742] Length = 305 Score = 184 bits (468), Expect = 2e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 57 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 116 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 117 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 150 >WP_072274367.1 putative colanic acid polymerase WcaD, partial [Citrobacter koseri] KXB40996.1 hypothetical protein HMPREF0208_03878, partial [Citrobacter koseri] Length = 258 Score = 183 bits (464), Expect = 2e-56 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNK+AI+KKLPLAIISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKDAIRKKLPLAIISL 250 >WP_074439559.1 putative colanic acid polymerase WcaD, partial [Citrobacter freundii] Length = 250 Score = 182 bits (463), Expect = 3e-56 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPK+DAMILAGI+LSGSFS Sbjct: 2 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKSDAMILAGIILSGSFS 61 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNK+AIKKKLPLAIISL Sbjct: 62 GVMTFILFYLLEWAFQYLNKDAIKKKLPLAIISL 95 >WP_073828094.1 putative colanic acid polymerase WcaD [Shigella boydii] Length = 274 Score = 183 bits (465), Expect = 3e-56 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDA+ILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDALILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >WP_000107780.1 hypothetical protein, partial [Shigella flexneri] ADA74495.1 putative colanic acid polymerase [Shigella flexneri 2002017] EFS14325.1 putative colanic acid polymerase domain protein [Shigella flexneri 2a str. 2457T] EGJ96611.1 putative membrane protein [Shigella flexneri 2930-71] EGK36451.1 putative colanic acid polymerase domain protein [Shigella flexneri K-304] EIQ25732.1 putative membrane protein [Shigella flexneri K-404] AIL36318.1 WcaD [Shigella flexneri 2003036] AIL41249.1 WcaD [Shigella flexneri Shi06HN006] KFZ98089.1 putative membrane protein [Shigella flexneri] CDX07504.1 putative colanic acid polymerase,putative colanic acid biosynthesis protein,putative colanic acid polymerase WcaD [Shigella flexneri] AKK54649.1 colanic acid polymerase [Shigella flexneri G1663] CEP58880.1 putative colanic acid polymerase [Shigella flexneri 2a] Length = 274 Score = 183 bits (465), Expect = 3e-56 Identities = 91/94 (96%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDA+ILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDALILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >WP_073691140.1 putative colanic acid polymerase WcaD, partial [Shigella boydii] Length = 321 Score = 184 bits (468), Expect = 4e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >EST77385.1 putative colanic acid biosynthesis protein, partial [Escherichia coli ECC-1470] Length = 325 Score = 184 bits (468), Expect = 4e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >ETJ28131.1 hypothetical protein Q609_ECAC00160G0007, partial [Escherichia coli DORA_A_5_14_21] Length = 330 Score = 184 bits (468), Expect = 5e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 157 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 216 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 217 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 250 >WP_040080041.1 putative colanic acid polymerase WcaD, partial [Escherichia coli] KIH16964.1 colanic acid biosynthesis protein, partial [Escherichia coli] Length = 343 Score = 184 bits (468), Expect = 6e-56 Identities = 92/94 (97%), Positives = 94/94 (100%) Frame = -2 Query: 284 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIVLSGSFS 105 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGI+LSGSFS Sbjct: 95 SYVLNFIKFGGKRTTALYFEPAFFALALISIWLSIKQFGIKTPKTDAMILAGIILSGSFS 154 Query: 104 GVMTFILFYLLEWAFQYLNKEAIKKKLPLAIISL 3 GVMTFILFYLLEWAFQYLNKEAIKKKLPLA+ISL Sbjct: 155 GVMTFILFYLLEWAFQYLNKEAIKKKLPLALISL 188