BLASTX nr result
ID: Glycyrrhiza28_contig00039502
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039502 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48505.1 hypothetical protein TSUD_291910 [Trifolium subterran... 89 2e-21 GAU12324.1 hypothetical protein TSUD_252750 [Trifolium subterran... 72 1e-13 XP_003608261.1 transmembrane protein, putative [Medicago truncat... 55 3e-08 >GAU48505.1 hypothetical protein TSUD_291910 [Trifolium subterraneum] Length = 112 Score = 89.4 bits (220), Expect = 2e-21 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = -3 Query: 239 GTFPLRNHFYHFLSDHDRSADCYWLRLDVFIATGIMWFTSLDPSLSFTFEYLN 81 GTFPLRNHF HFLSDHDRSADCYWLRLDVFIATGIMWFT + F + N Sbjct: 12 GTFPLRNHFDHFLSDHDRSADCYWLRLDVFIATGIMWFTREGRKIIVAFPFPN 64 >GAU12324.1 hypothetical protein TSUD_252750 [Trifolium subterraneum] Length = 207 Score = 72.0 bits (175), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 209 HFLSDHDRSADCYWLRLDVFIATGIMWFTSL 117 HFLSDHDRSADCYWLRLDVFIATGIMWFTSL Sbjct: 100 HFLSDHDRSADCYWLRLDVFIATGIMWFTSL 130 >XP_003608261.1 transmembrane protein, putative [Medicago truncatula] AES90458.1 transmembrane protein, putative [Medicago truncatula] Length = 77 Score = 55.1 bits (131), Expect = 3e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 199 QTMTGVLIAIGFGWMCSSPLASCG 128 QTMTGVLIAIGFGWMCSSPLASCG Sbjct: 31 QTMTGVLIAIGFGWMCSSPLASCG 54