BLASTX nr result
ID: Glycyrrhiza28_contig00039434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039434 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014519260.1 PREDICTED: uncharacterized protein LOC106776346 [... 66 1e-10 XP_017427958.1 PREDICTED: uncharacterized protein LOC108336123 [... 66 1e-10 XP_007157356.1 hypothetical protein PHAVU_002G063400g [Phaseolus... 64 9e-10 XP_003517602.1 PREDICTED: uncharacterized protein LOC100776639 [... 59 5e-08 XP_003519788.2 PREDICTED: uncharacterized protein LOC100776135 [... 55 8e-07 >XP_014519260.1 PREDICTED: uncharacterized protein LOC106776346 [Vigna radiata var. radiata] Length = 472 Score = 65.9 bits (159), Expect = 1e-10 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -1 Query: 169 MCWMHLVEGDVFPLAQSKSRNTHKFFVFVDGR-RRQGQCERIHTDSSIETRRLNFSS 2 MCW+ LVE DVFPL +SK NTH F FV R RRQGQCE+ H+D SIETR+ + SS Sbjct: 1 MCWIDLVE-DVFPLEESKPGNTH--FCFVPARTRRQGQCEQTHSDLSIETRKTDLSS 54 >XP_017427958.1 PREDICTED: uncharacterized protein LOC108336123 [Vigna angularis] KOM45725.1 hypothetical protein LR48_Vigan06g103100 [Vigna angularis] BAT99502.1 hypothetical protein VIGAN_10094900 [Vigna angularis var. angularis] Length = 472 Score = 65.9 bits (159), Expect = 1e-10 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -1 Query: 169 MCWMHLVEGDVFPLAQSKSRNTHKFFVFVDGR-RRQGQCERIHTDSSIETRRLNFSS 2 MCW+ LV GDVFPL +SK NTH F FV R RRQGQCE+ H+D SIETR+ + SS Sbjct: 1 MCWIDLV-GDVFPLEESKPGNTH--FCFVRARTRRQGQCEQTHSDLSIETRKTDLSS 54 >XP_007157356.1 hypothetical protein PHAVU_002G063400g [Phaseolus vulgaris] ESW29350.1 hypothetical protein PHAVU_002G063400g [Phaseolus vulgaris] Length = 472 Score = 63.5 bits (153), Expect = 9e-10 Identities = 36/57 (63%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -1 Query: 169 MCWMHLVEGDVFPLAQSKSRNTHKFFVFVDGR-RRQGQCERIHTDSSIETRRLNFSS 2 MCW+ LV GDVF LA+SK NTH F F R RRQGQCE+ HTD SIETR+ + SS Sbjct: 1 MCWIDLV-GDVFTLAESKPGNTH--FCFGHARTRRQGQCEQTHTDLSIETRKRDLSS 54 >XP_003517602.1 PREDICTED: uncharacterized protein LOC100776639 [Glycine max] KRH74550.1 hypothetical protein GLYMA_01G027800 [Glycine max] Length = 471 Score = 58.5 bits (140), Expect = 5e-08 Identities = 35/61 (57%), Positives = 38/61 (62%), Gaps = 5/61 (8%) Frame = -1 Query: 169 MCWMHLVEGDVFPLAQSKSRNTHKFFVFVDGRR-----RQGQCERIHTDSSIETRRLNFS 5 MCW+ LVE SK RNTH F FV GRR RQGQCE+ HTD SIET+R N S Sbjct: 1 MCWIDLVE--------SKPRNTH--FCFVHGRRKRRRRRQGQCEQSHTDLSIETKRQNLS 50 Query: 4 S 2 S Sbjct: 51 S 51 >XP_003519788.2 PREDICTED: uncharacterized protein LOC100776135 [Glycine max] KRH69613.1 hypothetical protein GLYMA_02G037400 [Glycine max] Length = 472 Score = 55.1 bits (131), Expect = 8e-07 Identities = 34/65 (52%), Positives = 37/65 (56%), Gaps = 9/65 (13%) Frame = -1 Query: 169 MCWMHLVEGDVFPLAQSKSRNTHKFFVFVDGR---------RRQGQCERIHTDSSIETRR 17 MCW+ LVE SK RNTH F FV GR RRQGQCE+ HTD IETR+ Sbjct: 1 MCWIDLVE--------SKPRNTH--FCFVHGRKRSRRRRRRRRQGQCEQSHTDLPIETRK 50 Query: 16 LNFSS 2 N SS Sbjct: 51 RNLSS 55