BLASTX nr result
ID: Glycyrrhiza28_contig00039399
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039399 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV93958.1 hypothetical protein TanjilG_05661 [Lupinus angustifo... 73 2e-13 XP_016737853.1 PREDICTED: 60S ribosomal protein L16, mitochondri... 61 4e-10 YP_007516924.1 hypothetical protein GlmaxMp75 (mitochondrion) [G... 52 1e-06 >OIV93958.1 hypothetical protein TanjilG_05661 [Lupinus angustifolius] Length = 476 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 222 FPILWWLIQRAGAPTVPAPASTLAPFGLEDHQ 127 FPILWWLIQRAGAPTVPAPASTLAPFGLEDHQ Sbjct: 281 FPILWWLIQRAGAPTVPAPASTLAPFGLEDHQ 312 >XP_016737853.1 PREDICTED: 60S ribosomal protein L16, mitochondrial-like [Gossypium hirsutum] Length = 146 Score = 61.2 bits (147), Expect = 4e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 201 IQRAGAPTVPAPASTLAPFGLEDHQVPSNS 112 + RAGAPTVPAPASTLAPFGLEDHQVPSNS Sbjct: 116 VLRAGAPTVPAPASTLAPFGLEDHQVPSNS 145 >YP_007516924.1 hypothetical protein GlmaxMp75 (mitochondrion) [Glycine max] AFR34376.1 hypothetical protein GlmaxMp75 (mitochondrion) [Glycine max] Length = 136 Score = 52.0 bits (123), Expect = 1e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 121 IQLTLVSMLIGFVLLHVGNQNRIIFST 41 IQLTLVSMLIGFVLLHVGNQNRI FST Sbjct: 110 IQLTLVSMLIGFVLLHVGNQNRIRFST 136