BLASTX nr result
ID: Glycyrrhiza28_contig00039171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039171 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV86768.1 hypothetical protein CFOL_v3_30194 [Cephalotus follic... 41 1e-06 GAV63635.1 hypothetical protein CFOL_v3_07153, partial [Cephalot... 42 2e-06 GAV76750.1 hypothetical protein CFOL_v3_20223 [Cephalotus follic... 42 3e-06 GAV61090.1 hypothetical protein CFOL_v3_04618 [Cephalotus follic... 39 9e-06 >GAV86768.1 hypothetical protein CFOL_v3_30194 [Cephalotus follicularis] Length = 237 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 Query: 53 KGKKQNAVAWTIRESKYYAMAQTTCELVWMMMSL 154 K KKQ+ VA + ES+Y AMA TTCEL+W+ L Sbjct: 128 KSKKQSVVARSSAESEYRAMAHTTCELMWVRQLL 161 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +3 Query: 192 KQIEEDSHFIQEKPQQGLNSATHVKWG 272 K IE DSHF++EK QQGL S HVK G Sbjct: 195 KHIEVDSHFVKEKIQQGLISTCHVKTG 221 >GAV63635.1 hypothetical protein CFOL_v3_07153, partial [Cephalotus follicularis] Length = 277 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = +2 Query: 53 KGKKQNAVAWTIRESKYYAMAQTTCELVWMMMSL 154 K KKQ+ VA + ESKY AMA TTCEL+W+ L Sbjct: 154 KSKKQSVVARSSAESKYRAMAHTTCELMWVKQLL 187 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +3 Query: 192 KQIEEDSHFIQEKPQQGLNSATHVKWG 272 K IE D HF++EK QQGL S HVK G Sbjct: 221 KHIEVDCHFVREKIQQGLISTCHVKTG 247 >GAV76750.1 hypothetical protein CFOL_v3_20223 [Cephalotus follicularis] Length = 228 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = +2 Query: 53 KGKKQNAVAWTIRESKYYAMAQTTCELVWMMMSL 154 K KKQ VA +I ES+Y AMA TTCEL+W+ L Sbjct: 127 KSKKQPVVARSIAESEYRAMAHTTCELMWVRQLL 160 Score = 36.2 bits (82), Expect(2) = 3e-06 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +3 Query: 192 KQIEEDSHFIQEKPQQGLNSATHVKWG 272 K IE D HF++EK QQGL S HVK G Sbjct: 194 KHIEVDCHFVREKIQQGLISTYHVKTG 220 >GAV61090.1 hypothetical protein CFOL_v3_04618 [Cephalotus follicularis] Length = 253 Score = 39.3 bits (90), Expect(2) = 9e-06 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = +2 Query: 53 KGKKQNAVAWTIRESKYYAMAQTTCELVWMMMSL 154 K +KQ+ VA + ES+Y AMA TTCEL+W+ L Sbjct: 128 KSEKQSVVARSSAESEYRAMAHTTCELMWVRQLL 161 Score = 37.4 bits (85), Expect(2) = 9e-06 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +3 Query: 192 KQIEEDSHFIQEKPQQGLNSATHVKWG 272 K IE D HF++EK QQGL S HVK G Sbjct: 195 KHIEVDCHFVREKTQQGLISTCHVKTG 221