BLASTX nr result
ID: Glycyrrhiza28_contig00038956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038956 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW15260.1 hypothetical protein TanjilG_16510 [Lupinus angustifo... 62 8e-09 XP_019437386.1 PREDICTED: serine/threonine protein phosphatase 2... 62 8e-09 >OIW15260.1 hypothetical protein TanjilG_16510 [Lupinus angustifolius] Length = 399 Score = 62.0 bits (149), Expect = 8e-09 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 217 MFKQIFSKLPRKSPKASEQVGSGSG-NHIVHSKPGNPSDSNARHDDGNN 360 MFKQI SKLPRKS K SE+ GS S NH+V+SK GNP D + H+ GNN Sbjct: 1 MFKQILSKLPRKSSKGSERGGSDSSENHVVYSKSGNPPDLDVGHNHGNN 49 >XP_019437386.1 PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' eta isoform-like [Lupinus angustifolius] Length = 495 Score = 62.0 bits (149), Expect = 8e-09 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 217 MFKQIFSKLPRKSPKASEQVGSGSG-NHIVHSKPGNPSDSNARHDDGNN 360 MFKQI SKLPRKS K SE+ GS S NH+V+SK GNP D + H+ GNN Sbjct: 1 MFKQILSKLPRKSSKGSERGGSDSSENHVVYSKSGNPPDLDVGHNHGNN 49