BLASTX nr result
ID: Glycyrrhiza28_contig00038869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038869 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN29531.1 hypothetical protein glysoja_005255 [Glycine soja] 54 4e-07 >KHN29531.1 hypothetical protein glysoja_005255 [Glycine soja] Length = 71 Score = 53.5 bits (127), Expect = 4e-07 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +2 Query: 95 VICLLSSPPTECQNATMY-QQIGRCPSIHSFPTLSK 199 + CLLSSPPTECQN T+Y Q+GRC SIHSF T+ + Sbjct: 1 MFCLLSSPPTECQNGTIYTYQVGRCMSIHSFRTVQE 36