BLASTX nr result
ID: Glycyrrhiza28_contig00038831
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038831 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF50715.1 nucleic acid binding protein, putative [Ricinus commu... 52 8e-06 >EEF50715.1 nucleic acid binding protein, putative [Ricinus communis] Length = 244 Score = 51.6 bits (122), Expect = 8e-06 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 3 GGLIRDSKGKFIHGFFCNVGCGS-SVVAEFLGLLLGVHLARRV 128 GGLIRDS+G++I GF C +G GS SV AE LGL+ G+ LAR++ Sbjct: 103 GGLIRDSRGRWIRGFKCYMGLGSTSVKAELLGLIEGLKLARKI 145