BLASTX nr result
ID: Glycyrrhiza28_contig00038829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038829 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAM88767.1 conserved hypothetical protein [Bradyrhizobium oligot... 56 3e-08 >BAM88767.1 conserved hypothetical protein [Bradyrhizobium oligotrophicum S58] Length = 102 Score = 55.8 bits (133), Expect = 3e-08 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -1 Query: 254 QPDNLGAEGVVIRNRYTVHS-HVKWCCRIGPQGIQHQSD 141 QPDNL A GVV RN S HVKWCCRIGP+GI+H+SD Sbjct: 59 QPDNLVAVGVVERNHDEGWSKHVKWCCRIGPEGIRHESD 97