BLASTX nr result
ID: Glycyrrhiza28_contig00038800
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038800 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489999.1 PREDICTED: alpha-amylase 3, chloroplastic isoform... 65 2e-10 >XP_004489999.1 PREDICTED: alpha-amylase 3, chloroplastic isoform X1 [Cicer arietinum] Length = 932 Score = 64.7 bits (156), Expect = 2e-10 Identities = 32/53 (60%), Positives = 38/53 (71%) Frame = -2 Query: 232 LNLNASFNFHQPHVPLSHHALAASVTDTPIPQSLHCSDTFFANTFPINRIQVV 74 + NASF + PH+PLS AL+ S TDT I SLHCSDTFF+NTF IN Q+V Sbjct: 41 IKFNASFTLYHPHMPLSS-ALSPSNTDTSIDHSLHCSDTFFSNTFTINTTQMV 92