BLASTX nr result
ID: Glycyrrhiza28_contig00038574
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Glycyrrhiza28_contig00038574
(211 letters)
Database: ./nr
115,041,592 sequences; 42,171,959,267 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AEW72799.1 DNA protection during starvation protein [Enterobacte... 106 2e-27
SAF21776.1 Uncharacterised protein [Enterobacter cloacae] 88 2e-21
EEJ49442.1 DNA protection during starvation protein [Escherichia... 83 3e-18
ESE14506.1 DNA protection during starvation protein [Escherichia... 83 3e-18
ESA73792.1 DNA protection during starvation protein [Escherichia... 83 3e-18
EGI16910.1 DNA protection during starvation protein [Escherichia... 83 3e-18
ABE06302.1 stationary phase nucleoid protein Dps [Escherichia co... 83 3e-18
EFJ65989.1 DNA protection during starvation protein [Escherichia... 83 4e-18
ABF03027.1 global regulator, starvation conditions [Shigella fle... 83 4e-18
EFU46659.1 DNA protection during starvation protein [Escherichia... 83 4e-18
EFJ82100.1 DNA protection during starvation protein [Escherichia... 83 4e-18
AKK38222.1 DNA starvation/stationary phase protection protein Dp... 83 4e-18
ETE12985.1 DNA starvation/stationary phase protection protein Dp... 83 4e-18
ESA85578.1 putative DNA protection during starvation protein [Es... 83 4e-18
AAC44603.1 DNA binding protein Dps/PexB, partial [Salmonella ent... 72 2e-15
SCZ29785.1 starvation-inducible DNA-binding protein [Enterobacte... 74 4e-15
WP_045261829.1 DNA starvation/stationary phase protection protei... 74 4e-15
CBK85594.1 DNA-binding ferritin-like protein (oxidative damage p... 74 4e-15
WP_000100801.1 MULTISPECIES: DNA starvation/stationary phase pro... 74 4e-15
KFU30075.1 DNA starvation/stationary phase protection protein Dp... 72 5e-15
>AEW72799.1 DNA protection during starvation protein [Enterobacter cloacae
EcWSU1]
Length = 186
Score = 106 bits (265), Expect = 2e-27
Identities = 53/57 (92%), Positives = 56/57 (98%)
Frame = -2
Query: 171 VLYLVP*LPGTQTSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
+LYL+P LPGTQTSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQV+
Sbjct: 1 MLYLIPQLPGTQTSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVI 57
>SAF21776.1 Uncharacterised protein [Enterobacter cloacae]
Length = 81
Score = 87.8 bits (216), Expect = 2e-21
Identities = 42/43 (97%), Positives = 43/43 (100%)
Frame = +1
Query: 1 DHLAIQQLDGRFFIAIRYIVTGIKQIRRFRFHQFSGTHNLISS 129
DHLAIQQL+GRFFIAIRYIVTGIKQIRRFRFHQFSGTHNLISS
Sbjct: 39 DHLAIQQLNGRFFIAIRYIVTGIKQIRRFRFHQFSGTHNLISS 81
>EEJ49442.1 DNA protection during starvation protein [Escherichia coli 83972]
EFJ53466.1 DNA protection during starvation protein
[Escherichia coli MS 185-1] EFJ90150.1 DNA protection
during starvation protein [Escherichia coli MS 45-1]
EFU51921.1 DNA protection during starvation protein
[Escherichia coli MS 153-1] AER83449.1 DNA
starvation/stationary phase protection [Escherichia coli
str. 'clone D i2'] AER88368.1 DNA starvation/stationary
phase protection [Escherichia coli str. 'clone D i14']
ESC96479.1 DNA protection during starvation protein
[Escherichia coli 907391] ESD33711.1 DNA protection
during starvation protein [Escherichia coli 907892]
ESE31290.1 DNA protection during starvation protein
[Escherichia coli A25922R] ETE18816.1 DNA
starvation/stationary phase protection protein Dps
[Escherichia coli LAU-EC6] KXG98141.1 DNA protection
during starvation protein [Escherichia coli]
Length = 198
Score = 83.2 bits (204), Expect = 3e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 25 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 69
>ESE14506.1 DNA protection during starvation protein [Escherichia coli
910096-2]
Length = 198
Score = 83.2 bits (204), Expect = 3e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 25 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 69
>ESA73792.1 DNA protection during starvation protein [Escherichia coli 110957]
ESD39801.1 DNA protection during starvation protein
[Escherichia coli 907889]
Length = 198
Score = 83.2 bits (204), Expect = 3e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 25 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 69
>EGI16910.1 DNA protection during starvation protein [Escherichia coli M605]
Length = 198
Score = 83.2 bits (204), Expect = 3e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 25 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 69
>ABE06302.1 stationary phase nucleoid protein Dps [Escherichia coli UTI89]
ABJ00192.1 stationary phase nucleoid protein Dps
[Escherichia coli APEC O1] CAP75282.1 DNA protection
during starvation protein [Escherichia coli LF82]
EFJ60024.1 DNA protection during starvation protein
[Escherichia coli MS 200-1] EFK18777.1 DNA protection
during starvation protein [Escherichia coli MS 21-1]
EGB78903.1 DNA protection during starvation protein
[Escherichia coli MS 57-2] EGB82299.1 DNA protection
during starvation protein [Escherichia coli MS 60-1]
EGI10346.1 DNA protection during starvation protein
[Escherichia coli H736] EGI22157.1 DNA protection during
starvation protein [Escherichia coli M718] EGI41877.1
DNA protection during starvation protein [Escherichia
coli TA280] EGI46537.1 DNA protection during starvation
protein [Escherichia coli H591] EGJ08040.1 DNA
protection during starvation protein [Escherichia coli
D9] ESA67718.1 DNA protection during starvation protein
[Escherichia coli 113290] ESD05801.1 DNA protection
during starvation protein [Escherichia coli 907672]
ESD33239.1 DNA protection during starvation protein
[Escherichia coli 908519] ESD69889.1 DNA protection
during starvation protein [Escherichia coli 908525]
ESE35205.1 DNA protection during starvation protein
[Escherichia coli A35218R] CDN81179.1 DNA protection
during starvation protein [Escherichia coli
O25b:H4-ST131] ALY12302.1 DNA starvation/stationary
phase protection protein Dps [Escherichia coli]
Length = 198
Score = 83.2 bits (204), Expect = 3e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 25 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 69
>EFJ65989.1 DNA protection during starvation protein [Escherichia coli MS
175-1] EFJ73877.1 DNA protection during starvation
protein [Escherichia coli MS 198-1] EFJ84647.1 DNA
protection during starvation protein [Escherichia coli
MS 84-1] EFK04180.1 DNA protection during starvation
protein [Escherichia coli MS 182-1] EFK16888.1 DNA
protection during starvation protein [Escherichia coli
MS 116-1] EFK26167.1 DNA protection during starvation
protein [Escherichia coli MS 187-1] EFK44316.1 DNA
protection during starvation protein [Escherichia coli
MS 119-7] EFK52212.1 DNA protection during starvation
protein [Escherichia coli MS 107-1] EFK68829.1 DNA
protection during starvation protein [Escherichia coli
MS 124-1] EFK73258.1 DNA protection during starvation
protein [Escherichia coli MS 78-1] EFK90322.1 DNA
protection during starvation protein [Escherichia coli
MS 146-1] EFO55634.1 DNA protection during starvation
protein [Escherichia coli MS 145-7] EFU37769.1 DNA
protection during starvation protein [Escherichia coli
MS 85-1] EGB87712.1 DNA protection during starvation
protein [Escherichia coli MS 117-3] EGU95058.1
stationary phase nucleoid protein Dps [Escherichia coli
MS 79-10] EID61348.1 DNA starvation/stationary phase
protection protein Dps [Shigella flexneri 5a str. M90T]
ESA62034.1 putative DNA protection during starvation
protein [Escherichia coli 113303] ESA80753.1 putative
DNA protection during starvation protein [Escherichia
coli 907713] ESA81156.1 putative DNA protection during
starvation protein [Escherichia coli 907357] ESA98132.1
putative DNA protection during starvation protein
[Escherichia coli 909945-2] ESC96696.1 putative DNA
protection during starvation protein [Escherichia coli
113302] ESD26850.1 putative DNA protection during
starvation protein [Escherichia coli 907710] ESD28429.1
putative DNA protection during starvation protein
[Escherichia coli 907715] ESD56482.1 putative DNA
protection during starvation protein [Escherichia coli
908521] ESD57448.1 putative DNA protection during
starvation protein [Escherichia coli 908522] ESD71698.1
putative DNA protection during starvation protein
[Escherichia coli 908555] ESD78366.1 putative DNA
protection during starvation protein [Escherichia coli
908541] ESD87594.1 putative DNA protection during
starvation protein [Escherichia coli 908585] ESD88411.1
putative DNA protection during starvation protein
[Escherichia coli 908616] ESE04592.1 putative DNA
protection during starvation protein [Escherichia coli
908658] ESU78387.1 Non-specific DNA-binding protein Dps
[Shigella dysenteriae WRSd3] ESU85050.1 Non-specific
DNA-binding protein Dps [Shigella dysenteriae WRSd5]
ETE28648.1 DNA starvation/stationary phase protection
protein Dps [Escherichia coli LAU-EC10] KXG94309.1
putative DNA protection during starvation protein
[Escherichia coli]
Length = 208
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 35 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 79
>ABF03027.1 global regulator, starvation conditions [Shigella flexneri 5 str.
8401] ADA73121.1 Global regulator, starvation conditions
[Shigella flexneri 2002017]
Length = 208
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 35 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 79
>EFU46659.1 DNA protection during starvation protein [Escherichia coli MS
110-3] EFU58593.1 DNA protection during starvation
protein [Escherichia coli MS 16-3] ESE13043.1 putative
DNA protection during starvation protein [Escherichia
coli 908675] AKK36759.1 DNA starvation/stationary phase
protection protein Dps [Escherichia coli APEC O18]
Length = 210
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 37 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 81
>EFJ82100.1 DNA protection during starvation protein [Escherichia coli MS 69-1]
ESD87001.1 putative DNA protection during starvation
protein [Escherichia coli 908573]
Length = 210
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 37 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 81
>AKK38222.1 DNA starvation/stationary phase protection protein Dps [Escherichia
coli APEC O2-211]
Length = 214
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 41 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 85
>ETE12985.1 DNA starvation/stationary phase protection protein Dps [Escherichia
coli LAU-EC8] ETE39334.1 DNA starvation/stationary phase
protection protein Dps [Escherichia coli LAU-EC9]
Length = 214
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 41 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 85
>ESA85578.1 putative DNA protection during starvation protein [Escherichia coli
907779] ESC91622.1 putative DNA protection during
starvation protein [Escherichia coli 907446] ESD07594.1
putative DNA protection during starvation protein
[Escherichia coli 907700] ESD19614.1 putative DNA
protection during starvation protein [Escherichia coli
907701] ESD52013.1 putative DNA protection during
starvation protein [Escherichia coli 908524] ESD93755.1
putative DNA protection during starvation protein
[Escherichia coli 908624] ESE06185.1 putative DNA
protection during starvation protein [Escherichia coli
908632] ESE24588.1 putative DNA protection during
starvation protein [Escherichia coli 908691] ETE26500.1
DNA starvation/stationary phase protection protein Dps
[Escherichia coli LAU-EC7] ANK06176.1 dps [Escherichia
coli O25b:H4]
Length = 214
Score = 83.2 bits (204), Expect = 4e-18
Identities = 40/45 (88%), Positives = 45/45 (100%)
Frame = -2
Query: 135 TSRGYEIMSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
TSRGYEIMSTAKLVK+KA+NLLYTRNDVSDS+KKAT+ELLNRQV+
Sbjct: 41 TSRGYEIMSTAKLVKSKATNLLYTRNDVSDSEKKATVELLNRQVI 85
>AAC44603.1 DNA binding protein Dps/PexB, partial [Salmonella enterica subsp.
enterica serovar Typhimurium str. SL1344]
Length = 38
Score = 72.0 bits (175), Expect = 2e-15
Identities = 35/38 (92%), Positives = 38/38 (100%)
Frame = -2
Query: 114 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
MSTAKLVKTKASNLLYTRNDVS+SDKKAT+ELLNRQV+
Sbjct: 1 MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVI 38
>SCZ29785.1 starvation-inducible DNA-binding protein [Enterobacter sp. NFIX45]
Length = 167
Score = 74.3 bits (181), Expect = 4e-15
Identities = 38/38 (100%), Positives = 38/38 (100%)
Frame = -2
Query: 114 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV
Sbjct: 1 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 38
>WP_045261829.1 DNA starvation/stationary phase protection protein [Enterobacter
hormaechei] KJN91250.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter hormaechei]
KJN96100.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei] KJO09443.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei] KJO21136.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei]
Length = 167
Score = 74.3 bits (181), Expect = 4e-15
Identities = 38/38 (100%), Positives = 38/38 (100%)
Frame = -2
Query: 114 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV
Sbjct: 1 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 38
>CBK85594.1 DNA-binding ferritin-like protein (oxidative damage protectant)
[Enterobacter cloacae subsp. cloacae NCTC 9394]
Length = 167
Score = 74.3 bits (181), Expect = 4e-15
Identities = 38/38 (100%), Positives = 38/38 (100%)
Frame = -2
Query: 114 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV
Sbjct: 1 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 38
>WP_000100801.1 MULTISPECIES: DNA starvation/stationary phase protection protein
[Bacteria] EGK62975.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter hormaechei ATCC
49162] EIM37102.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter cloacae subsp.
cloacae GS1] ERP02335.1 DNA protection during starvation
protein [Enterobacter sp. MGH 8] ERP06648.1 DNA
protection during starvation protein [Enterobacter sp.
MGH 14] ESL78569.1 DNA protection during starvation
protein [Enterobacter cloacae UCICRE 11] ESL87909.1 DNA
protection during starvation protein [Enterobacter
cloacae UCICRE 9] ESM17979.1 DNA protection during
starvation protein [Enterobacter cloacae UCICRE 5]
ESM19882.1 DNA protection during starvation protein
[Enterobacter cloacae UCICRE 3] ESM44553.1 DNA
protection during starvation protein [Enterobacter
cloacae BWH 29] ESM79606.1 DNA protection during
starvation protein [Enterobacter sp. MGH 38] ESN11328.1
DNA protection during starvation protein [Enterobacter
sp. MGH 26] CDL33703.1 Non-specific DNA-binding protein
Dps / Iron-binding ferritin-like antioxidant protein /
Ferroxidase [Enterobacter cloacae ISC8] EUL38561.1 DNA
protection during starvation protein [Enterobacter
cloacae UCI 50] EUL67575.1 DNA protection during
starvation protein [Enterobacter cloacae UCI 36]
EUL73232.1 DNA protection during starvation protein
[Enterobacter cloacae UCI 35] EUL77945.1 DNA protection
during starvation protein [Enterobacter cloacae UCI 30]
EUL93741.1 DNA protection during starvation protein
[Enterobacter cloacae UCI 23] EUM14827.1 DNA protection
during starvation protein [Enterobacter sp. BIDMC 28]
EUM19502.1 DNA protection during starvation protein
[Enterobacter sp. BIDMC 27] EUM33231.1 DNA protection
during starvation protein [Enterobacter cloacae BIDMC 8]
EUM35964.1 DNA protection during starvation protein
[Enterobacter sp. BWH 39] EUM54109.1 DNA protection
during starvation protein [Enterobacter sp. MGH 33]
EUM57348.1 DNA protection during starvation protein
[Enterobacter sp. MGH 15] EUM60876.1 DNA protection
during starvation protein [Enterobacter cloacae
'Hoffmann cluster III' MGH 13] EUM65499.1 DNA protection
during starvation protein [Enterobacter sp. MGH 11]
EUM67327.1 DNA protection during starvation protein
[Enterobacter sp. MGH 12] EUM79181.1 DNA protection
during starvation protein [Enterobacter sp. MGH 9]
EUM80940.1 DNA protection during starvation protein
[Enterobacter sp. MGH 7] EUM86344.1 DNA protection
during starvation protein [Enterobacter sp. MGH 10]
EUM87957.1 DNA protection during starvation protein
[Enterobacter sp. MGH 6] EUM96762.1 DNA protection
during starvation protein [Enterobacter sp. MGH 5]
EUM98415.1 DNA protection during starvation protein
[Enterobacter sp. MGH 4] EUN05364.1 DNA protection
during starvation protein [Enterobacter sp. MGH 2]
EUN06795.1 DNA protection during starvation protein
[Enterobacter sp. MGH 3] EUN07994.1 DNA protection
during starvation protein [Enterobacter sp. MGH 1]
EZR15593.1 DNA protection during starvation protein
[Enterobacter sp. BWH 27] KDF57935.1 DNA protection
during starvation protein [Enterobacter cloacae MGH 53]
KDM55004.1 DNA protection during starvation protein
[Lelliottia amnigena CHS 78] AIE63258.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae ECNIH2] AIN22026.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae ECNIH3] AIN27369.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae ECR091] KGY91565.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KGZ07883.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KHC08524.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] AIX58486.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KHG49315.1 DNA protection during
starvation protein [Enterobacter hormaechei subsp.
oharae] KHM05829.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter hormaechei subsp.
oharae] KHM09906.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter hormaechei subsp.
oharae] KHM10811.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter hormaechei subsp.
oharae] KHM19552.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KHM21069.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM29666.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM32055.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM43466.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM43874.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM63396.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM66234.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM67721.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM71767.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM73146.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM81186.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM86445.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHM89985.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHQ16766.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KHQ58900.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] AJB61929.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] AJB70345.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. hormaechei] AJB81061.1
DNA starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJC03058.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJF32060.1 DNA protection during
starvation protein [Enterobacter cloacae BIDMC 33A]
KJH96225.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae] KJH96772.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI06168.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI15981.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI19792.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI30358.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI38868.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI41146.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI45803.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI48183.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI55994.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI61781.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI73693.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI76947.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI79776.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI89265.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJI93395.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJJ01864.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJJ07525.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJJ08765.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJL57831.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJL58978.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJL65597.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJL72621.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJL77751.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJL89683.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJL92099.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJL98514.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJM21915.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJM22925.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJM31645.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJM51472.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJM59718.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJM65116.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJM75401.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJM76244.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJM81655.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei] KJM98053.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJN04821.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJN09981.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJN15267.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei]
KJN21851.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJN26526.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJN40529.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. hormaechei] KJN45004.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJN50696.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJN65169.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJN65307.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJN76656.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJN77565.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJN87302.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJO02792.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. hormaechei] KJO08017.1
DNA starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJO19247.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJO23798.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJO30843.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJO35747.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJO59320.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJO67532.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJO74543.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJO75208.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJO82431.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJO83902.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJO85169.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJO87778.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJP01842.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJP03113.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJP07496.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJP21298.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJP30426.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJP33755.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJP36436.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJP52659.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJP55035.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. oharae] KJP59220.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJP61029.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJP69584.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJP75150.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJP81656.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJP98193.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae] KJP98956.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ09024.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ13051.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ17071.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ22861.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ28398.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ29937.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ37353.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJQ43669.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KJW87387.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJW87693.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJW94718.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJX04560.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJX18981.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJX26498.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KJX31394.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJX42464.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJX45405.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KJX53924.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KJX56978.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KJX61554.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KJX65607.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KKA34525.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] CQR77224.1 DNA protection during
starvation protein [Enterobacter cloacae] KKJ35336.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei] KLE21922.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KLF79503.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLF80277.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLF92395.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KLF95457.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLG05581.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
AKK76011.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae] AKK93354.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] AKK95505.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] AKL50874.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] KLP61932.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLP78517.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLP82974.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KLP83582.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLP96320.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei] KLP97998.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KLP99967.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. oharae] KLQ18955.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLQ41241.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLQ46300.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KLQ55774.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLQ66877.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLQ72591.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KLQ76493.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLQ93695.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLQ97049.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KLR02413.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLR05857.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLR07015.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
subsp. steigerwaltii] KLR15341.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. hormaechei] KLR26367.1
DNA starvation/stationary phase protection protein Dps
[Enterobacter hormaechei] KLR28726.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
KLR40325.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp.
steigerwaltii] KLR66747.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter cloacae]
KLR70533.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae] KLW07732.1 DNA
protection during starvation protein [Enterobacter
cloacae] KLW13471.1 DNA protection during starvation
protein [Enterobacter cloacae] KLW18735.1 DNA protection
during starvation protein [Enterobacter sp. BWH52]
KLW23370.1 DNA protection during starvation protein
[Enterobacter sp. BWH64] KLW32291.1 DNA protection
during starvation protein [Enterobacter sp. MGH85]
KLW40540.1 DNA protection during starvation protein
[Enterobacter sp. MGH119] KLW41105.1 DNA protection
during starvation protein [Enterobacter sp. MGH120]
KLW48920.1 DNA protection during starvation protein
[Enterobacter sp. MGH86] KLW54164.1 DNA protection
during starvation protein [Enterobacter sp. MGH127]
KLW57281.1 DNA protection during starvation protein
[Enterobacter sp. MGH128] KLW58960.1 DNA protection
during starvation protein [Enterobacter sp. BIDMC93]
KLW65579.1 DNA protection during starvation protein
[Enterobacter sp. BIDMC87] KLW72927.1 DNA protection
during starvation protein [Enterobacter sp. BIDMC99]
KLW79290.1 DNA protection during starvation protein
[Enterobacter sp. BIDMC109] KLW81695.1 DNA protection
during starvation protein [Enterobacter sp. BIDMC100]
KLW93573.1 DNA protection during starvation protein
[Enterobacter sp. BIDMC110] AKZ83563.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
ALA01522.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
KOQ83964.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae subsp. cloacae]
KOQ90599.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae subsp. cloacae]
KPR17242.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae subsp. cloacae]
KRT40203.1 DNA starvation/stationary phase protection
protein Dps [Escherichia coli] KSZ09319.1 DNA
starvation/stationary phase protection protein
[Enterobacter sp. 50858885] KTG80429.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KTG84373.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KTG91845.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTG94710.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTG99392.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTH04444.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTH08394.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTH10550.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KTH20525.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KTH40094.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KTH47954.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTH52023.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTH57218.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTH61393.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTH83763.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTH88188.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI06335.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTI10719.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI12459.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI21964.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI30682.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI39377.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI41707.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI47337.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTI52784.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI62570.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTI72811.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTI75218.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTI76682.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTI91006.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTI94530.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KTI95402.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KTJ01327.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KTJ10293.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTJ14718.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ20500.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ32136.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTJ39954.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ41825.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ49036.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTJ54674.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ65488.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ71786.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KTJ77098.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KTJ86221.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ90038.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KTJ91561.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTJ94501.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KTK06005.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KTK07577.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KTK11724.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KTK24555.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTK29375.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KTK31581.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KTQ55057.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter asburiae] KTQ63590.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTQ66134.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter asburiae] KTQ71160.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTQ81234.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter asburiae] KTQ93543.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTQ94499.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTQ99266.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTR13555.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTR18351.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTR20033.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTR31890.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTR33998.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KTR42519.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter xiangfangensis] KUH52990.1 DNA
starvation/stationary phase protection protein
[Enterobacter cloacae subsp. cloacae] KUQ12485.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KUQ22283.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KUQ37023.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KUQ42097.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KUQ51010.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KUQ66978.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KUQ72167.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KUQ83889.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KUQ90922.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KUQ96437.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KUR19588.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVI50622.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVI59856.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVI61426.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVI67350.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVI87438.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVI93809.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVI94499.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVI98827.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KVJ04283.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KVJ12632.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KVJ18107.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KVJ24347.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KVJ30987.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KVJ37908.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. oharae] KVJ39121.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KVJ46846.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVJ48268.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVJ52124.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVJ54606.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVJ68573.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVJ75746.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVJ76078.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVJ84508.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVJ88906.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVK01957.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVK05429.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KVK07866.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVK18664.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVK21546.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVK28139.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KVK33578.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei] KYH17545.1 DNA
starvation/stationary phase protection protein
[Enterobacter cloacae] KYJ78734.1 DNA
starvation/stationary phase protection protein
[Enterobacter cloacae] KYO12102.1 DNA
starvation/stationary phase protection protein
[Enterobacter ludwigii] CZV67134.1 DNA protection during
starvation protein [Enterobacter cloacae] CZU77355.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZW24475.1 DNA protection during starvation
protein [Enterobacter cloacae] CZY66846.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZW73916.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU69158.1 DNA protection during
starvation protein [Enterobacter cloacae] CZY37868.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZX39530.1 DNA protection during starvation
protein [Enterobacter cloacae] CZY99963.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZW57880.1 DNA protection during starvation protein
[Enterobacter cloacae] CZX01337.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW81744.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZY69133.1 DNA protection during starvation
protein [Enterobacter cloacae] CZX81355.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZV14463.1 DNA protection during starvation protein
[Enterobacter cloacae] CZY80915.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW07889.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZX59200.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU68984.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZW34257.1 DNA protection during starvation protein
[Enterobacter cloacae] CZW90824.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW34026.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZU23772.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU26217.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZU41214.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU70535.1 DNA protection during
starvation protein [Enterobacter cloacae] CZY14672.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZY21834.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU75444.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZW44475.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU58412.1 DNA protection during
starvation protein [Enterobacter cloacae] CZY33425.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZV37009.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU47396.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZX57025.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU38687.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW52832.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZW27507.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU57856.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZV24445.1 DNA protection during starvation protein
[Enterobacter cloacae] CZW35666.1 DNA protection during
starvation protein [Enterobacter cloacae] CZY69108.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZW80245.1 DNA protection during starvation
protein [Enterobacter cloacae] CZZ03599.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZU29695.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU18594.1 DNA protection during
starvation protein [Enterobacter cloacae] CZX01733.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZU41766.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU19034.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZX40048.1 DNA protection during starvation protein
[Enterobacter cloacae] CZV21488.1 DNA protection during
starvation protein [Enterobacter cloacae] CZX94991.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZY92572.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU38036.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZV98011.1 DNA protection during starvation protein
[Enterobacter cloacae] CZY81326.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW87246.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZX03485.1 DNA protection during starvation
protein [Enterobacter cloacae] CZW85659.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZV56542.1 DNA protection during starvation protein
[Enterobacter cloacae] CZY06365.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW26290.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZX36380.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU29045.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZX68178.1 DNA protection during starvation protein
[Enterobacter cloacae] CZW94367.1 DNA protection during
starvation protein [Enterobacter cloacae] CZV96162.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZW92660.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU70468.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZU73436.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU79935.1 DNA protection during
starvation protein [Enterobacter cloacae] CZU89781.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZY35485.1 DNA protection during starvation
protein [Enterobacter cloacae] CZX10645.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZY66434.1 DNA protection during starvation protein
[Enterobacter cloacae] CZW67622.1 DNA protection during
starvation protein [Enterobacter cloacae] CZW64491.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZU40969.1 DNA protection during starvation
protein [Enterobacter cloacae] CZW67568.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZU52868.1 DNA protection during starvation protein
[Enterobacter cloacae] CZV76876.1 DNA protection during
starvation protein [Enterobacter cloacae] CZU62302.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZU84628.1 DNA protection during starvation
protein [Enterobacter cloacae] CZU46707.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZU31216.1 DNA protection during starvation protein
[Enterobacter cloacae] CZU83089.1 DNA protection during
starvation protein [Enterobacter cloacae] CZV86631.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZW84874.1 DNA protection during starvation
protein [Enterobacter cloacae] CZV35700.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAD10723.1 DNA protection during starvation protein
[Enterobacter cloacae] SAC79991.1 DNA protection during
starvation protein [Enterobacter cloacae] SAE59784.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAG34525.1 DNA protection during starvation
protein [Enterobacter cloacae] SAG26433.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAG96877.1 DNA protection during starvation protein
[Enterobacter cloacae] SAB61234.1 DNA protection during
starvation protein [Enterobacter cloacae] CZY79884.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAI14996.1 DNA protection during starvation
protein [Enterobacter cloacae] SAE54494.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAG19351.1 DNA protection during starvation protein
[Enterobacter cloacae] CZY78540.1 DNA protection during
starvation protein [Enterobacter cloacae] SAG36535.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAB75093.1 DNA protection during starvation
protein [Enterobacter cloacae] SAG79530.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAB66083.1 DNA protection during starvation protein
[Enterobacter cloacae] SAA97554.1 DNA protection during
starvation protein [[Enterobacter] aerogenes] SAC49673.1
DNA protection during starvation protein [Enterobacter
cloacae] SAD49001.1 DNA protection during starvation
protein [Enterobacter cloacae] CZZ00396.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAB65456.1 DNA protection during starvation protein
[Enterobacter cloacae] SAF91018.1 DNA protection during
starvation protein [Enterobacter cloacae] SAB64830.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAI18719.1 DNA protection during starvation
protein [Enterobacter cloacae] SAB66930.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAE65849.1 DNA protection during starvation protein
[Enterobacter cloacae] SAE19799.1 DNA protection during
starvation protein [Enterobacter cloacae] SAB15126.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAG03759.1 DNA protection during starvation
protein [Enterobacter cloacae] SAC53447.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAF52592.1 DNA protection during starvation protein
[Enterobacter cloacae] SAA14922.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD84842.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAH02695.1 DNA protection during starvation
protein [Enterobacter cloacae] SAH42150.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAE25678.1 DNA protection during starvation protein
[Enterobacter cloacae] SAB73954.1 DNA protection during
starvation protein [Enterobacter cloacae] SAH73358.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAD22384.1 DNA protection during starvation
protein [Enterobacter cloacae] SAB65866.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAB85062.1 DNA protection during starvation protein
[Enterobacter cloacae] SAF77728.1 DNA protection during
starvation protein [Enterobacter cloacae] SAA86664.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAC46208.1 DNA protection during starvation
protein [Enterobacter cloacae] SAE75272.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAB88658.1 DNA protection during starvation protein
[Enterobacter cloacae] SAI19390.1 DNA protection during
starvation protein [Enterobacter cloacae] CZZ51426.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAC50422.1 DNA protection during starvation
protein [Enterobacter cloacae] SAF78662.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAC35555.1 DNA protection during starvation protein
[Enterobacter cloacae] SAI63683.1 DNA protection during
starvation protein [Enterobacter cloacae] SAA49137.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAB64193.1 DNA protection during starvation
protein [Enterobacter cloacae] SAC45838.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAD33880.1 DNA protection during starvation protein
[Enterobacter cloacae] SAF82856.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD15100.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAB94689.1 DNA protection during starvation
protein [Enterobacter cloacae] SAB99247.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAA51742.1 DNA protection during starvation protein
[Enterobacter cloacae] SAA18216.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD91461.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAG46003.1 DNA protection during starvation
protein [Enterobacter cloacae] SAA56209.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAA00687.1 DNA protection during starvation protein
[Enterobacter cloacae] SAB19420.1 DNA protection during
starvation protein [Enterobacter cloacae] CZZ43828.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAE33366.1 DNA protection during starvation
protein [Enterobacter cloacae] SAD04269.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAG43207.1 DNA protection during starvation protein
[Enterobacter cloacae] SAA08150.1 DNA protection during
starvation protein [Enterobacter cloacae] SAE39257.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAI27211.1 DNA protection during starvation
protein [Enterobacter cloacae] CZZ67880.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAC70689.1 DNA protection during starvation protein
[Enterobacter cloacae] CZZ77762.1 DNA protection during
starvation protein [Enterobacter cloacae] SAC21954.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAE83581.1 DNA protection during starvation
protein [Enterobacter cloacae] CZZ73375.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAD87368.1 DNA protection during starvation protein
[Enterobacter cloacae] SAI16126.1 DNA protection during
starvation protein [Enterobacter cloacae] SAB53251.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAA01177.1 DNA protection during starvation
protein [Enterobacter cloacae] CZY51188.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAH85276.1 DNA protection during starvation protein
[Enterobacter cloacae] SAE28483.1 DNA protection during
starvation protein [Enterobacter cloacae] SAF52915.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAC68494.1 DNA protection during starvation
protein [Enterobacter cloacae] SAD11278.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAE47752.1 DNA protection during starvation protein
[Enterobacter cloacae] SAD41659.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD70459.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAF83091.1 DNA protection during starvation
protein [Enterobacter cloacae] SAF85125.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAA96530.1 DNA protection during starvation protein
[Enterobacter cloacae] SAA46032.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD23673.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAB54509.1 DNA protection during starvation
protein [Enterobacter cloacae] CZZ75017.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAB83963.1 DNA protection during starvation protein
[Enterobacter cloacae] SAB66046.1 DNA protection during
starvation protein [Enterobacter cloacae] SAF45273.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZZ43208.1 DNA protection during starvation
protein [Enterobacter cloacae] CZY93692.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAC00681.1 DNA protection during starvation protein
[Enterobacter cloacae] SAC09285.1 DNA protection during
starvation protein [Enterobacter cloacae] SAF00700.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAD13180.1 DNA protection during starvation
protein [Enterobacter cloacae] SAH67946.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAH15158.1 DNA protection during starvation protein
[Enterobacter cloacae] CZZ00362.1 DNA protection during
starvation protein [Enterobacter cloacae] SAB48101.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAA71884.1 DNA protection during starvation
protein [Enterobacter cloacae] CZY78953.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZZ31995.1 DNA protection during starvation protein
[Enterobacter cloacae] SAF27394.1 DNA protection during
starvation protein [Enterobacter cloacae] CZY44353.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAD44348.1 DNA protection during starvation
protein [Enterobacter cloacae] SAB42190.1 DNA protection
during starvation protein [[Enterobacter] aerogenes]
SAF69645.1 DNA protection during starvation protein
[Enterobacter cloacae] SAB14187.1 DNA protection during
starvation protein [Enterobacter cloacae] SAF11364.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAD89176.1 DNA protection during starvation
protein [Enterobacter cloacae] SAA43162.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAB66529.1 DNA protection during starvation protein
[Enterobacter cloacae] CZZ21677.1 DNA protection during
starvation protein [Enterobacter cloacae] SAG66701.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAB33507.1 DNA protection during starvation
protein [Enterobacter cloacae] SAB70309.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAG06671.1 DNA protection during starvation protein
[Enterobacter cloacae] SAA07926.1 DNA protection during
starvation protein [Enterobacter cloacae] SAG51088.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAG32449.1 DNA protection during starvation
protein [Enterobacter cloacae] SAF98229.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAA05187.1 DNA protection during starvation protein
[Enterobacter cloacae] CZY67521.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD13575.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAH27199.1 DNA protection during starvation
protein [Enterobacter cloacae] CZY62397.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAH31388.1 DNA protection during starvation protein
[Enterobacter cloacae] SAF47466.1 DNA protection during
starvation protein [Enterobacter cloacae] CZZ87495.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZY84735.1 DNA protection during starvation
protein [Enterobacter cloacae] SAH30192.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAD33015.1 DNA protection during starvation protein
[Enterobacter cloacae] SAD87197.1 DNA protection during
starvation protein [Enterobacter cloacae] SAG39399.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAH12170.1 DNA protection during starvation
protein [Enterobacter cloacae] SAE21600.1 DNA protection
during starvation protein [Enterobacter cloacae]
CZX95597.1 DNA protection during starvation protein
[Enterobacter cloacae] SAE33141.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD19853.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZZ30761.1 DNA protection during starvation
protein [[Enterobacter] aerogenes] CZZ34753.1 DNA
protection during starvation protein [Enterobacter
cloacae] CZZ26998.1 DNA protection during starvation
protein [Enterobacter cloacae] SAD47098.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAF67228.1 DNA protection during starvation protein
[Enterobacter cloacae] SAE56441.1 DNA protection during
starvation protein [Enterobacter cloacae] SAD30453.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAE81024.1 DNA protection during starvation
protein [Enterobacter cloacae] SAC18576.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAH95003.1 DNA protection during starvation protein
[Enterobacter cloacae] SAF88080.1 DNA protection during
starvation protein [Enterobacter cloacae] SAE39530.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAI11019.1 DNA protection during starvation
protein [Enterobacter cloacae] SAG53429.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAG20577.1 DNA protection during starvation protein
[Enterobacter cloacae] SAH60606.1 DNA protection during
starvation protein [Enterobacter cloacae] SAF02718.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAG00330.1 DNA protection during starvation
protein [Enterobacter cloacae] SAH71129.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAI92848.1 DNA protection during starvation protein
[Enterobacter cloacae] SAJ18144.1 DNA protection during
starvation protein [Enterobacter cloacae] SAI98943.1 DNA
protection during starvation protein [Enterobacter
cloacae] SAJ27258.1 DNA protection during starvation
protein [Enterobacter cloacae] SAJ16865.1 DNA protection
during starvation protein [Enterobacter cloacae]
SAJ21243.1 DNA protection during starvation protein
[Enterobacter cloacae] KZP51408.1 DNA
starvation/stationary phase protection protein
[Enterobacter hormaechei subsp. steigerwaltii]
KZP57022.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZP71098.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KZP80628.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZP83256.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. oharae]
KZP96087.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ12563.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ16928.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ29775.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ48610.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ88777.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ88971.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZQ99668.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZR08818.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZR19302.1 DNA starvation/stationary phase protection
protein [Enterobacter hormaechei subsp. steigerwaltii]
KZR36196.1 DNA starvation/stationary phase protection
protein [Enterobacter cloacae complex sp. GN06232]
OAE44792.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae] OAE70156.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] OAH34291.1 DNA
starvation/stationary phase protection protein
[Enterobacter xiangfangensis] SBL38904.1 Non-specific
DNA-binding protein Dps / Iron-binding ferritin-like
antioxidant protein / ferroxidase [Klebsiella oxytoca]
OAR71300.1 DNA starvation/stationary phase protection
protein [Enterobacter cloacae] OAR85061.1 DNA
starvation/stationary phase protection protein
[Enterobacter cloacae] OAZ41555.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae] ANS18474.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei] AOP77357.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter hormaechei subsp. steigerwaltii]
AOP81781.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter hormaechei subsp. oharae]
AOP90632.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter xiangfangensis] AOP99281.1 DNA
starvation/stationary phase protection protein Dps
[Enterobacter cloacae complex 'Hoffmann cluster III']
OEG83380.1 DNA starvation/stationary phase protection
protein Dps [Enterobacter cloacae complex 'Hoffmann
cluster III'] OEH22785.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter sp.
ST121:950178628] OIR53261.1 DNA starvation/stationary
phase protection protein Dps [Enterobacter hormaechei
ATCC 49162] APR42300.1 DNA starvation/stationary phase
protection protein Dps [Enterobacter cloacae] OOK76668.1
DNA starvation/stationary phase protection protein Dps
[Pedobacter himalayensis]
Length = 167
Score = 74.3 bits (181), Expect = 4e-15
Identities = 38/38 (100%), Positives = 38/38 (100%)
Frame = -2
Query: 114 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV
Sbjct: 1 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 38
>KFU30075.1 DNA starvation/stationary phase protection protein Dps, partial
[Salmonella enterica subsp. enterica serovar Bareilly
str. CFSAN000195]
Length = 90
Score = 72.0 bits (175), Expect = 5e-15
Identities = 35/38 (92%), Positives = 38/38 (100%)
Frame = -2
Query: 114 MSTAKLVKTKASNLLYTRNDVSDSDKKATIELLNRQVV 1
MSTAKLVKTKASNLLYTRNDVS+SDKKAT+ELLNRQV+
Sbjct: 1 MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVI 38