BLASTX nr result
ID: Glycyrrhiza28_contig00038571
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038571 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016165264.1 PREDICTED: uncharacterized protein LOC107607882 [... 60 2e-07 GAU21713.1 hypothetical protein TSUD_180570 [Trifolium subterran... 56 2e-06 XP_015962868.1 PREDICTED: uncharacterized protein LOC107486813 [... 56 3e-06 XP_016185849.1 PREDICTED: uncharacterized protein LOC107627531 [... 55 6e-06 >XP_016165264.1 PREDICTED: uncharacterized protein LOC107607882 [Arachis ipaensis] Length = 344 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +3 Query: 369 MNYLFWNCRGAGGREFPALIRDSARIYKLDMVAILEPQVSGDR 497 MN L WNCRGAGG+ FP LIRD R Y L+ V +LE +SGDR Sbjct: 1 MNILTWNCRGAGGKTFPNLIRDLKRDYDLNFVILLETHISGDR 43 >GAU21713.1 hypothetical protein TSUD_180570 [Trifolium subterraneum] Length = 243 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +3 Query: 369 MNYLFWNCRGAGGREFPALIRDSARIYKLDMVAILEPQVSGD 494 MN L WNCRGA G FP+LIRD RIY +D +AILE ++G+ Sbjct: 1 MNCLVWNCRGAIGHNFPSLIRDYTRIYHIDFLAILETCINGN 42 >XP_015962868.1 PREDICTED: uncharacterized protein LOC107486813 [Arachis duranensis] Length = 314 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +3 Query: 369 MNYLFWNCRGAGGREFPALIRDSARIYKLDMVAILEPQVSGDR 497 MN++ WNCRG GG+ FP LIRD R ++ + + +LE V+GDR Sbjct: 1 MNFIIWNCRGVGGKGFPTLIRDLRREFEANFIILLETHVNGDR 43 >XP_016185849.1 PREDICTED: uncharacterized protein LOC107627531 [Arachis ipaensis] Length = 469 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = +3 Query: 369 MNYLFWNCRGAGGREFPALIRDSARIYKLDMVAILEPQVSGDR 497 MN + WNCRGAGG+ FP LIRD R Y + + +LE +SG R Sbjct: 1 MNIISWNCRGAGGKTFPTLIRDIRREYNANFIILLETHISGSR 43