BLASTX nr result
ID: Glycyrrhiza28_contig00038483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038483 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018828531.1 PREDICTED: exocyst complex component EXO70B1-like... 62 1e-09 GAU44395.1 hypothetical protein TSUD_246210 [Trifolium subterran... 59 1e-08 XP_015874733.1 PREDICTED: exocyst complex component EXO70B1 isof... 59 2e-08 XP_015874732.1 PREDICTED: exocyst complex component EXO70B1 isof... 59 2e-08 XP_008349534.1 PREDICTED: exocyst complex component EXO70B1-like... 58 3e-08 GAV58664.1 Exo70 domain-containing protein [Cephalotus follicula... 57 1e-07 CDP09256.1 unnamed protein product [Coffea canephora] 56 1e-07 XP_008231770.1 PREDICTED: exocyst complex component EXO70B1-like... 56 2e-07 XP_020113543.1 exocyst complex component EXO70B1 [Ananas comosus] 56 2e-07 OAY69048.1 Exocyst complex component EXO70B1 [Ananas comosus] 56 2e-07 XP_003615884.1 exocyst subunit exo70 family protein [Medicago tr... 56 2e-07 XP_019159802.1 PREDICTED: exocyst complex component EXO70B1 [Ipo... 55 2e-07 KVH94095.1 Cullin repeat-like-containing domain-containing prote... 55 2e-07 XP_004294760.1 PREDICTED: exocyst complex component EXO70B1-like... 55 2e-07 XP_015948752.1 PREDICTED: exocyst complex component EXO70B1-like... 55 2e-07 XP_016542090.1 PREDICTED: LOW QUALITY PROTEIN: exocyst complex c... 55 3e-07 XP_019240870.1 PREDICTED: exocyst complex component EXO70B1 [Nic... 55 3e-07 KNA10568.1 hypothetical protein SOVF_143180 [Spinacia oleracea] 55 3e-07 XP_007142095.1 hypothetical protein PHAVU_008G252200g [Phaseolus... 55 3e-07 XP_004154337.1 PREDICTED: exocyst complex component EXO70B1 [Cuc... 55 3e-07 >XP_018828531.1 PREDICTED: exocyst complex component EXO70B1-like [Juglans regia] Length = 645 Score = 62.0 bits (149), Expect = 1e-09 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A ++E+LESNL+A SKIYKDS+L ++ M+NN RY+VHK K EL +L Sbjct: 455 LSVQMAWIMELLESNLEAKSKIYKDSALSYLFMMNNGRYIVHKVKDSELALLL 507 >GAU44395.1 hypothetical protein TSUD_246210 [Trifolium subterraneum] Length = 507 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVLA 166 L +H+ ++EVLESNL A SKIYKDS+LG+V ++N+ Y++ K K ++RK+L+ Sbjct: 308 LSLHMDRIMEVLESNLIAKSKIYKDSALGYVFLMNSNEYILQKTKNNDIRKLLS 361 >XP_015874733.1 PREDICTED: exocyst complex component EXO70B1 isoform X2 [Ziziphus jujuba] Length = 646 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 LFV + ++E+LE+NL+A SK+YKD +L V M+NN RY+VHK K EL +L Sbjct: 457 LFVQMVWIMELLETNLEAKSKVYKDPALCSVFMMNNGRYIVHKVKDSELGSLL 509 >XP_015874732.1 PREDICTED: exocyst complex component EXO70B1 isoform X1 [Ziziphus jujuba] Length = 646 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 LFV + ++E+LE+NL+A SK+YKD +L V M+NN RY+VHK K EL +L Sbjct: 457 LFVQMVWIMELLETNLEAKSKVYKDPALCSVFMMNNGRYIVHKVKDSELGSLL 509 >XP_008349534.1 PREDICTED: exocyst complex component EXO70B1-like [Malus domestica] Length = 634 Score = 58.2 bits (139), Expect = 3e-08 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = +2 Query: 11 VHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 V +A ++E+LESNL+A SKIY+DS+L +V M+NN RY+V KAK EL +L Sbjct: 444 VQMAWIMELLESNLEAKSKIYRDSALCYVFMMNNGRYIVQKAKDSELGLLL 494 >GAV58664.1 Exo70 domain-containing protein [Cephalotus follicularis] Length = 626 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A ++E+LESNL+ SKIYKDS+L V ++NN RY+V K K EL +L Sbjct: 436 LSVQIAWIMELLESNLEVKSKIYKDSALSSVFLMNNGRYIVQKVKDSELGSLL 488 >CDP09256.1 unnamed protein product [Coffea canephora] Length = 637 Score = 56.2 bits (134), Expect = 1e-07 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A ++E+LESNL+A SKIY+DS+L V M+NN RY+V K K EL +L Sbjct: 447 LAVQMAWIMELLESNLEAKSKIYRDSALCSVFMMNNGRYIVQKVKDSELGSLL 499 >XP_008231770.1 PREDICTED: exocyst complex component EXO70B1-like [Prunus mume] Length = 623 Score = 55.8 bits (133), Expect = 2e-07 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = +2 Query: 11 VHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 V +A ++E+LESNL+A SKIY+DS+L +V M+NN RY+V K + EL +L Sbjct: 435 VQMAWIMELLESNLEAKSKIYRDSALCYVFMMNNSRYIVQKVRDSELGSLL 485 >XP_020113543.1 exocyst complex component EXO70B1 [Ananas comosus] Length = 635 Score = 55.8 bits (133), Expect = 2e-07 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L VH+A +++VLE NL+A SKIY D SL V ++NN RY++ K K EL +L Sbjct: 453 LAVHIAWIMDVLERNLEAKSKIYPDPSLSCVFLLNNGRYIIQKVKDSELEVLL 505 >OAY69048.1 Exocyst complex component EXO70B1 [Ananas comosus] Length = 635 Score = 55.8 bits (133), Expect = 2e-07 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L VH+A +++VLE NL+A SKIY D SL V ++NN RY++ K K EL +L Sbjct: 453 LAVHIAWIMDVLERNLEAKSKIYPDPSLSCVFLLNNGRYIIQKVKDSELEVLL 505 >XP_003615884.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98842.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 697 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/53 (49%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L + ++ ++E+L+ NL+ANSKIYK+ SL +V ++NN RYMV K K EL +L Sbjct: 510 LSMQMSFIMELLDRNLEANSKIYKEPSLSYVFLMNNCRYMVQKTKDSELGTIL 562 >XP_019159802.1 PREDICTED: exocyst complex component EXO70B1 [Ipomoea nil] Length = 621 Score = 55.5 bits (132), Expect = 2e-07 Identities = 27/53 (50%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A ++E+LESNL+A SK+Y+DS+L + M+NN RY+V K K EL +L Sbjct: 436 LAVQMAWIMELLESNLEAKSKVYRDSALSSIFMMNNGRYIVQKVKDNELGTLL 488 >KVH94095.1 Cullin repeat-like-containing domain-containing protein [Cynara cardunculus var. scolymus] Length = 629 Score = 55.5 bits (132), Expect = 2e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A ++EVLESNL+A SKIY+D +L V M+NN RY+V K K EL +L Sbjct: 439 LAVQMAWIMEVLESNLEAKSKIYRDPALSSVFMMNNGRYIVKKVKDDELGSLL 491 >XP_004294760.1 PREDICTED: exocyst complex component EXO70B1-like [Fragaria vesca subsp. vesca] Length = 630 Score = 55.5 bits (132), Expect = 2e-07 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +2 Query: 11 VHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 V +A ++E+LESNL+A SKIY+DS+L V M+NN RY+V K K EL +L Sbjct: 443 VQMAWIMELLESNLEAKSKIYRDSALCSVFMMNNGRYIVQKVKDSELGSLL 493 >XP_015948752.1 PREDICTED: exocyst complex component EXO70B1-like [Arachis duranensis] Length = 636 Score = 55.5 bits (132), Expect = 2e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +2 Query: 11 VHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 V + ++++LESNL+A SKIYKD +L V M+NN RY+V KAK EL VL Sbjct: 436 VQLCGIMDLLESNLEAKSKIYKDLALCSVFMMNNLRYIVQKAKTSELGSVL 486 >XP_016542090.1 PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70B1 [Capsicum annuum] Length = 610 Score = 55.1 bits (131), Expect = 3e-07 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A ++E+LESNL+A SKIYK+S+L V M+NN RY+V K K EL +L Sbjct: 420 LAVQMAWIMELLESNLEAKSKIYKESALLAVFMMNNERYIVQKVKDSELELLL 472 >XP_019240870.1 PREDICTED: exocyst complex component EXO70B1 [Nicotiana attenuata] OIT19915.1 exocyst complex component exo70b1 [Nicotiana attenuata] Length = 625 Score = 55.1 bits (131), Expect = 3e-07 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V +A +E+LESNL+A SKIYKDS+L V M+NN RY+V K K EL +L Sbjct: 435 LAVQMAWTMELLESNLEAKSKIYKDSALMAVFMMNNERYIVQKVKDSELGLLL 487 >KNA10568.1 hypothetical protein SOVF_143180 [Spinacia oleracea] Length = 630 Score = 55.1 bits (131), Expect = 3e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCEL 151 L V +A ++E+LESNL+A SK+YKD +L V M+NN RY+V K K EL Sbjct: 438 LSVQMAWIMELLESNLEAKSKVYKDPALSSVFMMNNGRYIVQKVKDSEL 486 >XP_007142095.1 hypothetical protein PHAVU_008G252200g [Phaseolus vulgaris] XP_007142096.1 hypothetical protein PHAVU_008G252200g [Phaseolus vulgaris] ESW14089.1 hypothetical protein PHAVU_008G252200g [Phaseolus vulgaris] ESW14090.1 hypothetical protein PHAVU_008G252200g [Phaseolus vulgaris] Length = 630 Score = 55.1 bits (131), Expect = 3e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V + ++E+LESNL+A SKIYKD +L +V ++NN RY+V KAK EL +L Sbjct: 442 LSVQMDWIMELLESNLEAKSKIYKDPALCYVFLMNNGRYIVQKAKDSELGTLL 494 >XP_004154337.1 PREDICTED: exocyst complex component EXO70B1 [Cucumis sativus] KGN65838.1 hypothetical protein Csa_1G533450 [Cucumis sativus] Length = 634 Score = 55.1 bits (131), Expect = 3e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +2 Query: 5 LFVHVAPVLEVLESNLKANSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 163 L V + ++E+LESNL+A SKIYKD SL V ++NN RY+V K K EL VL Sbjct: 449 LSVQMDWIMELLESNLEAKSKIYKDLSLSSVFLMNNGRYIVQKVKDSELGSVL 501