BLASTX nr result
ID: Glycyrrhiza28_contig00038263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038263 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22227.1 hypothetical protein TSUD_227630 [Trifolium subterran... 54 2e-06 >GAU22227.1 hypothetical protein TSUD_227630 [Trifolium subterraneum] Length = 465 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +2 Query: 2 ERRSMQERRVQKPEPANSFIGIHGMRLETE 91 ERRSMQERRV KPEP NSFIGI GMRLE E Sbjct: 430 ERRSMQERRVWKPEPGNSFIGIPGMRLERE 459