BLASTX nr result
ID: Glycyrrhiza28_contig00038157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038157 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_006022588.1 MULTISPECIES: hypothetical protein [Rhizobiales] ... 61 1e-10 WP_054181164.1 oxidoreductase [Trabulsiella odontotermitis] 53 2e-06 WP_061070885.1 oxidoreductase [Achromobacter xylosoxidans] AMG34... 52 5e-06 WP_040125139.1 short-chain dehydrogenase DltE [Neorhizobium gale... 51 9e-06 >WP_006022588.1 MULTISPECIES: hypothetical protein [Rhizobiales] EKS37458.1 hypothetical protein HMPREF9695_03876 [Afipia broomeae ATCC 49717] CEG10292.1 hypothetical protein BN961_03730 [Afipia felis] KIU49898.1 hypothetical protein QU41_10785 [Bradyrhizobium elkanii] AKR57839.1 hypothetical protein XM25_19030 [Devosia sp. H5989] KQT28389.1 hypothetical protein ASG57_17125 [Bradyrhizobium sp. Leaf396] OCX32019.1 hypothetical protein QU42_05135 [Bradyrhizobium sp. UASWS1016] Length = 68 Score = 60.8 bits (146), Expect = 1e-10 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +1 Query: 109 MFLRSVLXXXXXXXXVLPAESVFAEGARKANQGQQREIGS 228 MFLRSVL VLPAESVFAEGARKANQGQQREIGS Sbjct: 1 MFLRSVLAAAAFAAAVLPAESVFAEGARKANQGQQREIGS 40 >WP_054181164.1 oxidoreductase [Trabulsiella odontotermitis] Length = 251 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 GGEILLNRDHARR*AERDGTYDSIFAAMNP 90 GGEILL RD ARR AERDGTYD+IF AMNP Sbjct: 221 GGEILLERDKARRWAERDGTYDAIFRAMNP 250 >WP_061070885.1 oxidoreductase [Achromobacter xylosoxidans] AMG34792.1 oxidoreductase [Achromobacter xylosoxidans] Length = 251 Score = 52.0 bits (123), Expect = 5e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 4 GEILLNRDHARR*AERDGTYDSIFAAMNP 90 GE+LL RD ARR AERDGTYD+IFAAMNP Sbjct: 222 GELLLERDQARRWAERDGTYDAIFAAMNP 250 >WP_040125139.1 short-chain dehydrogenase DltE [Neorhizobium galegae] CDN57883.1 Short-chain dehydrogenase, teichoic and lipoteichoic acid D-alanine esterification (plasmid) [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141] Length = 251 Score = 51.2 bits (121), Expect = 9e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 4 GEILLNRDHARR*AERDGTYDSIFAAMNPS 93 GE+LL RD ARR AERDGTYD+IFAA+NP+ Sbjct: 222 GELLLERDQARRWAERDGTYDNIFAALNPA 251