BLASTX nr result
ID: Glycyrrhiza28_contig00038149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038149 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024578468.1 MULTISPECIES: AraC family transcriptional regulat... 69 1e-11 SEB84214.1 transcriptional regulator, AraC family with amidase-l... 67 9e-11 WP_050401365.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 64 4e-10 WP_050420203.1 AraC family transcriptional regulator [Bradyrhizo... 64 6e-10 WP_050632055.1 AraC family transcriptional regulator [Bradyrhizo... 64 6e-10 ERF81429.1 alkane 1-monooxygenase [Bradyrhizobium sp. DFCI-1] 64 6e-10 WP_076832220.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_057019976.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_050632053.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_050386574.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_038388313.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_028344917.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_028332269.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 63 1e-09 WP_024578469.1 MULTISPECIES: thiamine biosynthesis protein ThiJ ... 63 1e-09 WP_016844522.1 dimethylglycine dehydrogenase [Bradyrhizobium elk... 63 1e-09 WP_018271394.1 dimethylglycine dehydrogenase [Bradyrhizobium elk... 63 1e-09 WP_076860139.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 62 2e-09 WP_028164075.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 62 2e-09 WP_063695151.1 AraC family transcriptional regulator [Bradyrhizo... 62 3e-09 WP_027584147.1 thiamine biosynthesis protein ThiJ [Bradyrhizobiu... 62 3e-09 >WP_024578468.1 MULTISPECIES: AraC family transcriptional regulator [Bradyrhizobium] KIU47938.1 AraC family transcriptional regulator [Bradyrhizobium elkanii] OCX26928.1 AraC family transcriptional regulator [Bradyrhizobium sp. UASWS1016] Length = 312 Score = 69.3 bits (168), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 102 MIDMLIFPDFQLLDAAGPISAFEIAARFANNPPD 1 MI MLIFPDFQLLDAAGPISAFEIAARFANNPPD Sbjct: 1 MIGMLIFPDFQLLDAAGPISAFEIAARFANNPPD 34 >SEB84214.1 transcriptional regulator, AraC family with amidase-like domain [Bradyrhizobium erythrophlei] Length = 312 Score = 66.6 bits (161), Expect = 9e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 102 MIDMLIFPDFQLLDAAGPISAFEIAARFANNPPD 1 MI +LIFPDFQLLDAAGPI+AFEIAARFANNPPD Sbjct: 1 MIGILIFPDFQLLDAAGPIAAFEIAARFANNPPD 34 >WP_050401365.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium embrapense] Length = 228 Score = 63.9 bits (154), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_050420203.1 AraC family transcriptional regulator [Bradyrhizobium sp. NAS96.2] OKO70049.1 AraC family transcriptional regulator [Bradyrhizobium sp. NAS96.2] Length = 312 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 102 MIDMLIFPDFQLLDAAGPISAFEIAARFANNPP 4 MI +LIFPDFQLLDAAGPI+AFEIAARFANNPP Sbjct: 1 MIGILIFPDFQLLDAAGPIAAFEIAARFANNPP 33 >WP_050632055.1 AraC family transcriptional regulator [Bradyrhizobium viridifuturi] Length = 312 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 102 MIDMLIFPDFQLLDAAGPISAFEIAARFANNPP 4 MI +LIFPDFQLLDAAGPI+AFEIAARFANNPP Sbjct: 1 MIGILIFPDFQLLDAAGPIAAFEIAARFANNPP 33 >ERF81429.1 alkane 1-monooxygenase [Bradyrhizobium sp. DFCI-1] Length = 312 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 102 MIDMLIFPDFQLLDAAGPISAFEIAARFANNPP 4 MI +LIFPDFQLLDAAGPI+AFEIAARFANNPP Sbjct: 1 MIGILIFPDFQLLDAAGPIAAFEIAARFANNPP 33 >WP_076832220.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium sp. UFLA 03-321] SDE02621.1 cyclohexyl-isocyanide hydratase [Bradyrhizobium sp. R5] OMI02552.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium sp. UFLA 03-321] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_057019976.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium pachyrhizi] KRP87847.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium pachyrhizi] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_050632053.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium viridifuturi] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 MS+PLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MSDPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_050386574.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium pachyrhizi] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_038388313.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_028344917.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_028332269.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_024578469.1 MULTISPECIES: thiamine biosynthesis protein ThiJ [Bradyrhizobium] KIU47937.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] OCX26929.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium sp. UASWS1016] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_016844522.1 dimethylglycine dehydrogenase [Bradyrhizobium elkanii] OIM89356.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_018271394.1 dimethylglycine dehydrogenase [Bradyrhizobium elkanii] ODM78015.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] ODM78836.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] Length = 228 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M+EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MTEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_076860139.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium sp. SEMIA 6399] Length = 228 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 M EPLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MPEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_028164075.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium elkanii] Length = 228 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 MS PLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MSSPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31 >WP_063695151.1 AraC family transcriptional regulator [Bradyrhizobium embrapense] Length = 312 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 102 MIDMLIFPDFQLLDAAGPISAFEIAARFANNPP 4 MI +LIFPDFQLLDAAGPI+AFEIAARFAN+PP Sbjct: 1 MIGILIFPDFQLLDAAGPIAAFEIAARFANDPP 33 >WP_027584147.1 thiamine biosynthesis protein ThiJ [Bradyrhizobium sp. Ai1a-2] Length = 228 Score = 61.6 bits (148), Expect = 3e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 231 MSEPLQIGLLVFPKVTQLDLTGPLQVFSSVP 323 MS PLQIGLLVFPKVTQLDLTGPLQVFSSVP Sbjct: 1 MSTPLQIGLLVFPKVTQLDLTGPLQVFSSVP 31