BLASTX nr result
ID: Glycyrrhiza28_contig00038135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038135 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573527.1 PREDICTED: protein trichome birefringence-like 21... 62 2e-09 XP_019419875.1 PREDICTED: protein trichome birefringence-like 19... 61 6e-09 KYP50387.1 hypothetical protein KK1_027864, partial [Cajanus cajan] 59 2e-08 XP_016182249.1 PREDICTED: protein trichome birefringence-like 19... 56 2e-07 XP_003541704.1 PREDICTED: protein trichome birefringence-like 19... 55 4e-07 XP_015943150.1 PREDICTED: protein trichome birefringence-like 19... 55 6e-07 XP_014517458.1 PREDICTED: protein trichome birefringence-like 19... 53 4e-06 XP_017435891.1 PREDICTED: protein trichome birefringence-like 19... 53 4e-06 >XP_012573527.1 PREDICTED: protein trichome birefringence-like 21 [Cicer arietinum] Length = 409 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSSE 251 MES+ TEL K K+A KNIPK VF+ P+T ++V+LLPL +LNQSSS+ Sbjct: 1 MESEATELFKSKFALKNIPKRVFIFPITALILVILLPLFTHLNQSSSK 48 >XP_019419875.1 PREDICTED: protein trichome birefringence-like 19 isoform X1 [Lupinus angustifolius] OIV95232.1 hypothetical protein TanjilG_21622 [Lupinus angustifolius] Length = 413 Score = 60.8 bits (146), Expect = 6e-09 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSS 245 M+ +V E+ KC Y +NIPKGVFLLP+T+ +IV+L PLI NLN SS Sbjct: 1 MKFEVPEILKCNYTTRNIPKGVFLLPLTLLIIVVLFPLIRNLNLSS 46 >KYP50387.1 hypothetical protein KK1_027864, partial [Cajanus cajan] Length = 416 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSSE 251 +E + E+ CKY++ NIPKG FLLP+T+FLIV+LLP + NL Q SS+ Sbjct: 1 LEFEAREMFNCKYSSANIPKGAFLLPLTLFLIVLLLPFLRNLIQPSSK 48 >XP_016182249.1 PREDICTED: protein trichome birefringence-like 19 [Arachis ipaensis] Length = 413 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSSE 251 M+ + TE+ KC YAA+NIP+GV LLP T+ +IV+L PL+ LN S+S+ Sbjct: 1 MKLEGTEILKCNYAARNIPRGVVLLPFTLVVIVLLFPLLRTLNLSASK 48 >XP_003541704.1 PREDICTED: protein trichome birefringence-like 19 [Glycine max] KHN08442.1 hypothetical protein glysoja_014207 [Glycine soja] KRH21282.1 hypothetical protein GLYMA_13G230100 [Glycine max] Length = 411 Score = 55.5 bits (132), Expect = 4e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSS 248 M+ +V EL K YAA+NIPKGVFLLP T FL+V++L LI NLN+S S Sbjct: 1 MKIEVLELLKNNYAARNIPKGVFLLPFT-FLVVVILLLITNLNESYS 46 >XP_015943150.1 PREDICTED: protein trichome birefringence-like 19 [Arachis duranensis] Length = 413 Score = 55.1 bits (131), Expect = 6e-07 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSSE 251 M+ + TE+ KC YAA+NIP+GV LLP T+ +I++L PL+ LN S+S+ Sbjct: 1 MKLEGTEILKCNYAARNIPRGVVLLPFTLVVILLLFPLLRTLNLSASK 48 >XP_014517458.1 PREDICTED: protein trichome birefringence-like 19 [Vigna radiata var. radiata] Length = 413 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSS 248 M+ +V E+ K YAAK IPKG LP+T+ L+V+ +PLI+NL++S S Sbjct: 1 MKIEVLEVLKSNYAAKGIPKGALALPLTLLLVVLFVPLIMNLHESYS 47 >XP_017435891.1 PREDICTED: protein trichome birefringence-like 19 [Vigna angularis] KOM53685.1 hypothetical protein LR48_Vigan09g234400 [Vigna angularis] BAT87183.1 hypothetical protein VIGAN_05052600 [Vigna angularis var. angularis] Length = 413 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 108 MESKVTELCKCKYAAKNIPKGVFLLPVTVFLIVMLLPLIINLNQSSS 248 M+ +V+E+ K YAAK IPKG LP+T+ ++V+ +PLI+NL++S S Sbjct: 1 MKIEVSEVLKSNYAAKGIPKGALALPLTLLVVVLFIPLIMNLHESYS 47