BLASTX nr result
ID: Glycyrrhiza28_contig00038019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038019 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW15545.1 hypothetical protein TanjilG_01068 [Lupinus angustifo... 61 4e-09 >OIW15545.1 hypothetical protein TanjilG_01068 [Lupinus angustifolius] Length = 1048 Score = 61.2 bits (147), Expect = 4e-09 Identities = 39/82 (47%), Positives = 39/82 (47%) Frame = +3 Query: 3 ESAHDAWKVGEESDSKPSAIDHVELKHLRKKLITFG*FDAHSDTVHIKSQHRHNQVAATS 182 ESAHDAWKVG HN VAATS Sbjct: 911 ESAHDAWKVG------------------------------------------HNLVAATS 928 Query: 183 QAHQMQTWLLLALARPSTASTA 248 QAHQMQTWLLLALARPSTASTA Sbjct: 929 QAHQMQTWLLLALARPSTASTA 950