BLASTX nr result
ID: Glycyrrhiza28_contig00037399
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037399 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019456395.1 PREDICTED: AT-rich interactive domain-containing ... 62 1e-08 XP_019430232.1 PREDICTED: AT-rich interactive domain-containing ... 62 1e-08 OIW16646.1 hypothetical protein TanjilG_23148 [Lupinus angustifo... 62 1e-08 KYP33701.1 hypothetical protein KK1_045434 [Cajanus cajan] 61 2e-08 XP_007135372.1 hypothetical protein PHAVU_010G123900g [Phaseolus... 59 9e-08 XP_014521624.1 PREDICTED: AT-rich interactive domain-containing ... 55 2e-06 KOM57003.1 hypothetical protein LR48_Vigan11g003500 [Vigna angul... 55 4e-06 XP_017442635.1 PREDICTED: AT-rich interactive domain-containing ... 55 4e-06 XP_003627823.1 AT-rich interactive domain protein [Medicago trun... 53 8e-06 >XP_019456395.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Lupinus angustifolius] XP_019456396.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Lupinus angustifolius] OIW04542.1 hypothetical protein TanjilG_13924 [Lupinus angustifolius] Length = 780 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MFQFHPQ + KQTCTLLAVTC TSF +QKP Q+ YP Sbjct: 1 MFQFHPQASTKQTCTLLAVTCGTSFEQQKPSQNHHNYP 38 >XP_019430232.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X1 [Lupinus angustifolius] XP_019430239.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X2 [Lupinus angustifolius] Length = 779 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MFQFHPQG KQTCTLLAVTC +SF +QKP +Q YP Sbjct: 1 MFQFHPQGTIKQTCTLLAVTCGSSFEQQKPSHNQHNYP 38 >OIW16646.1 hypothetical protein TanjilG_23148 [Lupinus angustifolius] Length = 1027 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MFQFHPQG KQTCTLLAVTC +SF +QKP +Q YP Sbjct: 1 MFQFHPQGTIKQTCTLLAVTCGSSFEQQKPSHNQHNYP 38 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/55 (50%), Positives = 34/55 (61%) Frame = +2 Query: 209 TVRN*TESLRCLTIT*TMFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 T+ + +LR L FHPQG KQTCTLLAVTC +SF +QKP +Q YP Sbjct: 232 TIHDDEVNLRFLVCGAPSTVFHPQGTIKQTCTLLAVTCGSSFEQQKPSHNQHNYP 286 >KYP33701.1 hypothetical protein KK1_045434 [Cajanus cajan] Length = 781 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MF FHPQGAPK TCTLLAVTC SF E K Q+Q YP Sbjct: 1 MFPFHPQGAPKHTCTLLAVTCGASFAEHKSSQNQRNYP 38 >XP_007135372.1 hypothetical protein PHAVU_010G123900g [Phaseolus vulgaris] ESW07366.1 hypothetical protein PHAVU_010G123900g [Phaseolus vulgaris] Length = 781 Score = 59.3 bits (142), Expect = 9e-08 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MF FHP GAPK CTLLAVTC SF E K Q+Q KYP Sbjct: 1 MFPFHPHGAPKHACTLLAVTCGASFAEHKASQNQHKYP 38 >XP_014521624.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Vigna radiata var. radiata] Length = 782 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MF FHP G PK CTLLAVTC SF E Q+Q KYP Sbjct: 2 MFPFHPHGVPKHACTLLAVTCGASFAEHMSSQNQHKYP 39 >KOM57003.1 hypothetical protein LR48_Vigan11g003500 [Vigna angularis] Length = 757 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MF FHP G PK CTLLAVTC SF E Q+Q KYP Sbjct: 1 MFPFHPHGVPKHACTLLAVTCGASFSEHMSSQNQHKYP 38 >XP_017442635.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Vigna angularis] BAT98236.1 hypothetical protein VIGAN_09187600 [Vigna angularis var. angularis] Length = 781 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 MF FHP G PK CTLLAVTC SF E Q+Q KYP Sbjct: 1 MFPFHPHGVPKHACTLLAVTCGASFSEHMSSQNQHKYP 38 >XP_003627823.1 AT-rich interactive domain protein [Medicago truncatula] ABE87648.1 DNA binding , related [Medicago truncatula] AET02299.1 AT-rich interactive domain protein [Medicago truncatula] Length = 204 Score = 52.8 bits (125), Expect = 8e-06 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +2 Query: 260 MFQFHPQGAPKQTCTLLAVTCATSFVEQKPPQDQCKYP 373 M QF PQG KQTCTLLAVT T VEQK Q+Q KYP Sbjct: 1 MLQFQPQGTSKQTCTLLAVTSETRSVEQKQLQNQHKYP 38