BLASTX nr result
ID: Glycyrrhiza28_contig00037370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037370 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442215.1 NB-ARC domain disease resistance protein, putativ... 113 4e-27 CAC86495.1 RGA-F protein, partial [Cicer arietinum] 100 2e-24 XP_004498673.1 PREDICTED: putative disease resistance RPP13-like... 100 2e-22 XP_003598093.2 NB-ARC domain disease resistance protein [Medicag... 99 3e-22 XP_012575446.1 PREDICTED: putative disease resistance RPP13-like... 86 1e-17 XP_012567318.1 PREDICTED: LOW QUALITY PROTEIN: putative disease ... 84 8e-17 XP_007220296.1 hypothetical protein PRUPE_ppa000407mg [Prunus pe... 80 1e-15 ONI20916.1 hypothetical protein PRUPE_2G040700 [Prunus persica] 80 1e-15 KYP41054.1 Putative disease resistance RPP13-like protein 1 [Caj... 79 4e-15 KYP41066.1 Putative disease resistance RPP13-like protein 1 [Caj... 79 4e-15 XP_013466896.1 NB-ARC domain disease resistance protein [Medicag... 77 2e-14 XP_003598466.1 LRR and NB-ARC domain disease resistance protein ... 77 3e-14 AAL01029.1 NBS/LRR resistance protein-like protein, partial [The... 73 5e-14 CAC86456.1 RGA-F3 protein, partial [Cicer reticulatum] 72 7e-14 AAL00995.1 NBS/LRR resistance protein-like protein, partial [The... 71 2e-13 AAL00994.1 NBS/LRR resistance protein-like protein, partial [The... 71 2e-13 XP_007220964.1 hypothetical protein PRUPE_ppa026310mg, partial [... 74 3e-13 ONI21026.1 hypothetical protein PRUPE_2G046000 [Prunus persica] 74 3e-13 XP_008245919.1 PREDICTED: putative disease resistance RPP13-like... 73 3e-13 XP_008246144.1 PREDICTED: putative disease resistance RPP13-like... 73 4e-13 >XP_013442215.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] KEH16240.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] Length = 1982 Score = 113 bits (282), Expect = 4e-27 Identities = 61/97 (62%), Positives = 70/97 (72%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 KE FDLKGWAYISKDFDIVRVTKTLLESVT K I +N++ + + +TSK Sbjct: 212 KEKFDLKGWAYISKDFDIVRVTKTLLESVTFKTIDANNMNTMHTEFVTSKI--------- 262 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 DT DLNTLQVQL+QSL HK+FLLVLDD+W GS Sbjct: 263 ----TDTGDLNTLQVQLQQSLIHKRFLLVLDDMWDGS 295 >CAC86495.1 RGA-F protein, partial [Cicer arietinum] Length = 185 Score = 99.8 bits (247), Expect = 2e-24 Identities = 56/96 (58%), Positives = 67/96 (69%) Frame = -1 Query: 288 EIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSVA 109 E FDLKGWAYISKDFDIVRVTKTLLES T ++I + + + +TS Sbjct: 20 EKFDLKGWAYISKDFDIVRVTKTLLESATLESID----TTIHTEFVTS------------ 63 Query: 108 PKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 +R DTSDLN LQVQL+Q+L+HK FLLVLDD+W GS Sbjct: 64 -RRTDTSDLNNLQVQLQQNLNHKTFLLVLDDMWDGS 98 >XP_004498673.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X1 [Cicer arietinum] XP_004498674.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X2 [Cicer arietinum] Length = 1238 Score = 99.8 bits (247), Expect = 2e-22 Identities = 56/96 (58%), Positives = 67/96 (69%) Frame = -1 Query: 288 EIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSVA 109 E FDLKGWAYISKDFDIVRVTKTLLES T ++I + + + +TS Sbjct: 213 EKFDLKGWAYISKDFDIVRVTKTLLESATLESID----TTIHTEFVTS------------ 256 Query: 108 PKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 +R DTSDLN LQVQL+Q+L+HK FLLVLDD+W GS Sbjct: 257 -RRTDTSDLNNLQVQLQQNLNHKTFLLVLDDMWDGS 291 >XP_003598093.2 NB-ARC domain disease resistance protein [Medicago truncatula] AES68344.2 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1069 Score = 99.4 bits (246), Expect = 3e-22 Identities = 55/95 (57%), Positives = 66/95 (69%), Gaps = 1/95 (1%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 KE FDLKGWAYISKDFDIV+VTKTL+ES TS+ I +N N + Sbjct: 123 KENFDLKGWAYISKDFDIVQVTKTLVESFTSETIDTNN--------------HNTPHAEF 168 Query: 111 AP-KRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 +P KR DT+DLNTLQV+L++ + HKKFLLVLDDIW Sbjct: 169 SPSKRTDTNDLNTLQVRLQRIIRHKKFLLVLDDIW 203 >XP_012575446.1 PREDICTED: putative disease resistance RPP13-like protein 1 [Cicer arietinum] Length = 1221 Score = 86.3 bits (212), Expect = 1e-17 Identities = 48/93 (51%), Positives = 60/93 (64%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 K+ FDLK WAYISK FD++ V KT+LES+ S+ IS DN+ PL+S +K D N+ Sbjct: 194 KDNFDLKVWAYISKHFDVLTVIKTILESIASQTISSDNMDSQPLESFIAKRNDTND---- 249 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDI 13 + T D N L V L Q LS KKFLLVLDD+ Sbjct: 250 ----VKTIDQNLLLVTLLQILSTKKFLLVLDDV 278 >XP_012567318.1 PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein At3g14460 [Cicer arietinum] Length = 1222 Score = 84.0 bits (206), Expect = 8e-17 Identities = 46/93 (49%), Positives = 60/93 (64%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 K+ F+LK WAYIS DFD++ V KT++ES+TS IS DN+ PL+S +K D ++ Sbjct: 196 KDKFELKVWAYISNDFDVLTVIKTIIESITSPTISSDNMDSQPLESFIAKRNDTSD---- 251 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDI 13 + T D N L V L Q LS KKFLLVLDD+ Sbjct: 252 ----VKTIDQNLLLVTLLQILSTKKFLLVLDDV 280 >XP_007220296.1 hypothetical protein PRUPE_ppa000407mg [Prunus persica] Length = 1203 Score = 80.5 bits (197), Expect = 1e-15 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 1/95 (1%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLP-LKSITSKAFDNNNLSS 115 KE F LK WA +S+D+D +RVTKTLL+SVT + + +L + L+S+TS+ + +L+ Sbjct: 223 KEHFTLKAWACVSEDYDAIRVTKTLLQSVTLEPCNKTDLKQITLLESVTSEPCNKTDLNQ 282 Query: 114 VAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 + +DLN LQV+L + LS KKFL VLDD W Sbjct: 283 ITL----LTDLNLLQVKLSEELSGKKFLFVLDDFW 313 >ONI20916.1 hypothetical protein PRUPE_2G040700 [Prunus persica] Length = 1305 Score = 80.5 bits (197), Expect = 1e-15 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 1/95 (1%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLP-LKSITSKAFDNNNLSS 115 KE F LK WA +S+D+D +RVTKTLL+SVT + + +L + L+S+TS+ + +L+ Sbjct: 223 KEHFTLKAWACVSEDYDAIRVTKTLLQSVTLEPCNKTDLKQITLLESVTSEPCNKTDLNQ 282 Query: 114 VAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 + +DLN LQV+L + LS KKFL VLDD W Sbjct: 283 ITL----LTDLNLLQVKLSEELSGKKFLFVLDDFW 313 >KYP41054.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 993 Score = 79.0 bits (193), Expect = 4e-15 Identities = 47/97 (48%), Positives = 55/97 (56%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 +E FDLK WAYIS DFD+ +VT+T+LESVT K FD NN Sbjct: 225 QEKFDLKAWAYISNDFDVCKVTRTILESVTFKP------------------FDTNN---- 262 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 LN LQV+L+QSL K+FLLVLDDIW GS Sbjct: 263 ---------LNILQVELQQSLIQKRFLLVLDDIWNGS 290 >KYP41066.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1173 Score = 79.0 bits (193), Expect = 4e-15 Identities = 47/97 (48%), Positives = 55/97 (56%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 +E FDLK WAYIS DFD+ +VT+T+LESVT K FD NN Sbjct: 225 QEKFDLKAWAYISNDFDVCKVTRTILESVTFKP------------------FDTNN---- 262 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 LN LQV+L+QSL K+FLLVLDDIW GS Sbjct: 263 ---------LNILQVELQQSLIQKRFLLVLDDIWNGS 290 >XP_013466896.1 NB-ARC domain disease resistance protein [Medicago truncatula] KEH40937.1 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 376 Score = 76.6 bits (187), Expect = 2e-14 Identities = 46/94 (48%), Positives = 53/94 (56%) Frame = -1 Query: 282 FDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSVAPK 103 FDLK WAYISKDFD+ RVTK +LES IT K D NN Sbjct: 229 FDLKAWAYISKDFDVCRVTKVILES------------------ITFKPVDTNN------- 263 Query: 102 RIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 LN LQV+L+QSL +++FLLVLDDIW GS Sbjct: 264 ------LNILQVELQQSLRNRRFLLVLDDIWDGS 291 >XP_003598466.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68717.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1216 Score = 76.6 bits (187), Expect = 3e-14 Identities = 46/94 (48%), Positives = 53/94 (56%) Frame = -1 Query: 282 FDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSVAPK 103 FDLK WAYISKDFD+ RVTK +LES IT K D NN Sbjct: 229 FDLKAWAYISKDFDVCRVTKVILES------------------ITFKPVDTNN------- 263 Query: 102 RIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGS 1 LN LQV+L+QSL +++FLLVLDDIW GS Sbjct: 264 ------LNILQVELQQSLRNRRFLLVLDDIWDGS 291 >AAL01029.1 NBS/LRR resistance protein-like protein, partial [Theobroma cacao] Length = 174 Score = 72.8 bits (177), Expect = 5e-14 Identities = 37/94 (39%), Positives = 55/94 (58%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 ++ FDLK W +S +FD++++TKT+LESVTS++ + Sbjct: 20 RDYFDLKAWVCVSNEFDVIKITKTILESVTSQSCN------------------------- 54 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 +DLN+LQV+LK++LS KKFLLVLDD+W Sbjct: 55 ------KNDLNSLQVELKENLSSKKFLLVLDDVW 82 >CAC86456.1 RGA-F3 protein, partial [Cicer reticulatum] Length = 153 Score = 72.0 bits (175), Expect = 7e-14 Identities = 41/83 (49%), Positives = 52/83 (62%) Frame = -1 Query: 261 YISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSVAPKRIDTSDL 82 YISK FD++ V KT+LES+ S+ IS DN+ PL+S +K D N+ + T D Sbjct: 1 YISKHFDVLTVIKTILESIASQTISSDNMDSQPLESFIAKRNDTND--------VKTIDQ 52 Query: 81 NTLQVQLKQSLSHKKFLLVLDDI 13 N L V L Q LS KKFLLVLDD+ Sbjct: 53 NLLLVTLLQILSTKKFLLVLDDV 75 >AAL00995.1 NBS/LRR resistance protein-like protein, partial [Theobroma cacao] Length = 173 Score = 71.2 bits (173), Expect = 2e-13 Identities = 37/94 (39%), Positives = 54/94 (57%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 ++ FDLK W +S +FD+++ TKT+LESVTS++ + Sbjct: 19 RDYFDLKAWVCVSNEFDVIKTTKTILESVTSQSCN------------------------- 53 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 +DLN+LQV+LK++LS KKFLLVLDD+W Sbjct: 54 ------KNDLNSLQVELKENLSGKKFLLVLDDVW 81 >AAL00994.1 NBS/LRR resistance protein-like protein, partial [Theobroma cacao] Length = 173 Score = 71.2 bits (173), Expect = 2e-13 Identities = 37/94 (39%), Positives = 54/94 (57%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 ++ FDLK W +S +FD+++ TKT+LESVTS++ + Sbjct: 19 RDYFDLKAWVCVSNEFDVIKTTKTILESVTSQSCN------------------------- 53 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 +DLN+LQV+LK++LS KKFLLVLDD+W Sbjct: 54 ------KNDLNSLQVELKENLSGKKFLLVLDDVW 81 >XP_007220964.1 hypothetical protein PRUPE_ppa026310mg, partial [Prunus persica] Length = 1029 Score = 73.6 bits (179), Expect = 3e-13 Identities = 43/94 (45%), Positives = 53/94 (56%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 KE F+L+ WAY+S+DFD+ RVTKTLLESV+SKA YDN Sbjct: 217 KEHFNLRTWAYVSEDFDVTRVTKTLLESVSSKA--YDN---------------------- 252 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 DL+ LQV+L Q + KKFL VLDD+W Sbjct: 253 -------KDLSCLQVELGQQIKGKKFLFVLDDLW 279 >ONI21026.1 hypothetical protein PRUPE_2G046000 [Prunus persica] Length = 1034 Score = 73.6 bits (179), Expect = 3e-13 Identities = 43/94 (45%), Positives = 53/94 (56%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 KE F+L+ WAY+S+DFD+ RVTKTLLESV+SKA YDN Sbjct: 217 KEHFNLRTWAYVSEDFDVTRVTKTLLESVSSKA--YDN---------------------- 252 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 DL+ LQV+L Q + KKFL VLDD+W Sbjct: 253 -------KDLSCLQVELGQQIKGKKFLFVLDDLW 279 >XP_008245919.1 PREDICTED: putative disease resistance RPP13-like protein 1, partial [Prunus mume] Length = 357 Score = 73.2 bits (178), Expect = 3e-13 Identities = 43/94 (45%), Positives = 53/94 (56%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 KE F+L+ WAY+S+DFD+ RVTKTLLESV+SKA YDN Sbjct: 220 KEHFNLRTWAYVSEDFDVTRVTKTLLESVSSKA--YDN---------------------- 255 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 DL+ LQV+L Q + KKFL VLDD+W Sbjct: 256 -------KDLSFLQVELGQQIKGKKFLFVLDDLW 282 >XP_008246144.1 PREDICTED: putative disease resistance RPP13-like protein 1, partial [Prunus mume] Length = 428 Score = 73.2 bits (178), Expect = 4e-13 Identities = 43/94 (45%), Positives = 53/94 (56%) Frame = -1 Query: 291 KEIFDLKGWAYISKDFDIVRVTKTLLESVTSKAISYDNLSPLPLKSITSKAFDNNNLSSV 112 KE F+L+ WAY+S+DFD+ RVTKTLLESV+SKA YDN Sbjct: 291 KEHFNLRTWAYVSEDFDVTRVTKTLLESVSSKA--YDN---------------------- 326 Query: 111 APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIW 10 DL+ LQV+L Q + KKFL VLDD+W Sbjct: 327 -------KDLSFLQVELGQQIKGKKFLFVLDDLW 353