BLASTX nr result
ID: Glycyrrhiza28_contig00037219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037219 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH01050.1 hypothetical protein GLYMA_18G250400 [Glycine max] 71 2e-13 GAU22904.1 hypothetical protein TSUD_377160 [Trifolium subterran... 74 3e-13 OIV96849.1 hypothetical protein TanjilG_08710 [Lupinus angustifo... 74 3e-13 XP_004502686.1 PREDICTED: WD repeat-containing protein 44-like [... 74 3e-13 XP_019417475.1 PREDICTED: uncharacterized protein LOC109328460 [... 74 3e-13 XP_014518865.1 PREDICTED: WD repeat-containing protein 44 [Vigna... 74 4e-13 XP_017422649.1 PREDICTED: WD repeat-containing protein 44 [Vigna... 74 4e-13 XP_007136464.1 hypothetical protein PHAVU_009G047400g [Phaseolus... 74 4e-13 XP_003527990.1 PREDICTED: WD repeat-containing protein 44-like [... 73 5e-13 XP_004309119.1 PREDICTED: WD repeat-containing protein 44-like [... 72 1e-12 KYP57700.1 WD repeat-containing protein 44 [Cajanus cajan] 71 2e-12 XP_016650269.1 PREDICTED: uncharacterized protein LOC103333609 i... 71 3e-12 XP_007220614.1 hypothetical protein PRUPE_ppa002072mg [Prunus pe... 71 3e-12 XP_008234700.1 PREDICTED: uncharacterized protein LOC103333609 i... 71 3e-12 XP_016163292.1 PREDICTED: WD repeat-containing protein 44 [Arach... 71 3e-12 XP_015934379.1 PREDICTED: WD repeat-containing protein 44 [Arach... 71 3e-12 KHN19514.1 WD repeat-containing protein 44 [Glycine soja] 70 5e-12 XP_003522540.1 PREDICTED: WD repeat-containing protein 44-like [... 70 5e-12 XP_013461436.1 transducin/WD40 repeat protein [Medicago truncatu... 69 1e-11 XP_018824711.1 PREDICTED: uncharacterized protein LOC108994078 [... 69 2e-11 >KRH01050.1 hypothetical protein GLYMA_18G250400 [Glycine max] Length = 169 Score = 71.2 bits (173), Expect = 2e-13 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVP 200 SCKST+ AHAW MVIVTAGW+GRIKSFHNYGLP+P Sbjct: 134 SCKSTSSAHAWGMVIVTAGWNGRIKSFHNYGLPIP 168 >GAU22904.1 hypothetical protein TSUD_377160 [Trifolium subterraneum] Length = 660 Score = 73.9 bits (180), Expect = 3e-13 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST CAHAW MVIVTAGWDGRIKSF NYGLP PV Sbjct: 625 SCKSTVCAHAWGMVIVTAGWDGRIKSFQNYGLPAPV 660 >OIV96849.1 hypothetical protein TanjilG_08710 [Lupinus angustifolius] Length = 676 Score = 73.9 bits (180), Expect = 3e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST+C+HAW MVIV+AGWDGRIKSFHN+GLP+PV Sbjct: 641 SCKSTSCSHAWGMVIVSAGWDGRIKSFHNHGLPIPV 676 >XP_004502686.1 PREDICTED: WD repeat-containing protein 44-like [Cicer arietinum] Length = 705 Score = 73.9 bits (180), Expect = 3e-13 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST AHAW MVIVTAGWDGRIKSFHNYGLPVPV Sbjct: 670 SCKSTARAHAWGMVIVTAGWDGRIKSFHNYGLPVPV 705 >XP_019417475.1 PREDICTED: uncharacterized protein LOC109328460 [Lupinus angustifolius] XP_019417476.1 PREDICTED: uncharacterized protein LOC109328460 [Lupinus angustifolius] Length = 720 Score = 73.9 bits (180), Expect = 3e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST+C+HAW MVIV+AGWDGRIKSFHN+GLP+PV Sbjct: 685 SCKSTSCSHAWGMVIVSAGWDGRIKSFHNHGLPIPV 720 >XP_014518865.1 PREDICTED: WD repeat-containing protein 44 [Vigna radiata var. radiata] Length = 699 Score = 73.6 bits (179), Expect = 4e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST+ AHAW MVIVTAGWDGRIK+FHNYGLP+PV Sbjct: 664 SCKSTSSAHAWGMVIVTAGWDGRIKAFHNYGLPIPV 699 >XP_017422649.1 PREDICTED: WD repeat-containing protein 44 [Vigna angularis] KOM41374.1 hypothetical protein LR48_Vigan04g157200 [Vigna angularis] BAT78862.1 hypothetical protein VIGAN_02161200 [Vigna angularis var. angularis] Length = 699 Score = 73.6 bits (179), Expect = 4e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST+ AHAW MVIVTAGWDGRIK+FHNYGLP+PV Sbjct: 664 SCKSTSSAHAWGMVIVTAGWDGRIKAFHNYGLPIPV 699 >XP_007136464.1 hypothetical protein PHAVU_009G047400g [Phaseolus vulgaris] ESW08458.1 hypothetical protein PHAVU_009G047400g [Phaseolus vulgaris] Length = 702 Score = 73.6 bits (179), Expect = 4e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST+ AH+W MVIVTAGWDGRIKSFHNYGLP+PV Sbjct: 667 SCKSTSSAHSWGMVIVTAGWDGRIKSFHNYGLPIPV 702 >XP_003527990.1 PREDICTED: WD repeat-containing protein 44-like [Glycine max] KRH53545.1 hypothetical protein GLYMA_06G131400 [Glycine max] KRH53546.1 hypothetical protein GLYMA_06G131400 [Glycine max] Length = 701 Score = 73.2 bits (178), Expect = 5e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVP 200 SCKST+ AHAW MVIVTAGWDGRIKSFHNYGLP+P Sbjct: 666 SCKSTSSAHAWGMVIVTAGWDGRIKSFHNYGLPIP 700 >XP_004309119.1 PREDICTED: WD repeat-containing protein 44-like [Fragaria vesca subsp. vesca] Length = 709 Score = 72.4 bits (176), Expect = 1e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC+ST+ +HAW MVIVTAGWDGRIKSFHNYGLPVPV Sbjct: 673 SCQSTSSSHAWGMVIVTAGWDGRIKSFHNYGLPVPV 708 >KYP57700.1 WD repeat-containing protein 44 [Cajanus cajan] Length = 649 Score = 71.2 bits (173), Expect = 2e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVP 200 SCKST HAW MVIVTAGWDGRIKSFHNYGLP+P Sbjct: 614 SCKSTATGHAWGMVIVTAGWDGRIKSFHNYGLPIP 648 >XP_016650269.1 PREDICTED: uncharacterized protein LOC103333609 isoform X2 [Prunus mume] Length = 720 Score = 71.2 bits (173), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC+ST+ +HAW MVIVTAGWDGRI+SFHNYGLPVPV Sbjct: 685 SCQSTSSSHAWGMVIVTAGWDGRIRSFHNYGLPVPV 720 >XP_007220614.1 hypothetical protein PRUPE_ppa002072mg [Prunus persica] ONI25679.1 hypothetical protein PRUPE_2G314500 [Prunus persica] ONI25680.1 hypothetical protein PRUPE_2G314500 [Prunus persica] ONI25681.1 hypothetical protein PRUPE_2G314500 [Prunus persica] Length = 720 Score = 71.2 bits (173), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC+ST+ +HAW MVIVTAGWDGRI+SFHNYGLPVPV Sbjct: 685 SCQSTSSSHAWGMVIVTAGWDGRIRSFHNYGLPVPV 720 >XP_008234700.1 PREDICTED: uncharacterized protein LOC103333609 isoform X1 [Prunus mume] XP_016650268.1 PREDICTED: uncharacterized protein LOC103333609 isoform X1 [Prunus mume] Length = 738 Score = 71.2 bits (173), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC+ST+ +HAW MVIVTAGWDGRI+SFHNYGLPVPV Sbjct: 703 SCQSTSSSHAWGMVIVTAGWDGRIRSFHNYGLPVPV 738 >XP_016163292.1 PREDICTED: WD repeat-containing protein 44 [Arachis ipaensis] Length = 706 Score = 70.9 bits (172), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC+ST+ +HAW MVIVTAGWDGRIK+FHNYGLPVPV Sbjct: 671 SCRSTSRSHAWGMVIVTAGWDGRIKTFHNYGLPVPV 706 >XP_015934379.1 PREDICTED: WD repeat-containing protein 44 [Arachis duranensis] Length = 706 Score = 70.9 bits (172), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC+ST+ +HAW MVIVTAGWDGRIK+FHNYGLPVPV Sbjct: 671 SCRSTSRSHAWGMVIVTAGWDGRIKTFHNYGLPVPV 706 >KHN19514.1 WD repeat-containing protein 44 [Glycine soja] Length = 703 Score = 70.5 bits (171), Expect = 5e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPV 203 SCKST+ AHAW MVIVTAGWDGRIKSFHNYGLP+ Sbjct: 668 SCKSTSSAHAWGMVIVTAGWDGRIKSFHNYGLPI 701 >XP_003522540.1 PREDICTED: WD repeat-containing protein 44-like [Glycine max] XP_014630420.1 PREDICTED: WD repeat-containing protein 44-like [Glycine max] KRH64387.1 hypothetical protein GLYMA_04G233400 [Glycine max] KRH64388.1 hypothetical protein GLYMA_04G233400 [Glycine max] KRH64389.1 hypothetical protein GLYMA_04G233400 [Glycine max] Length = 703 Score = 70.5 bits (171), Expect = 5e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPV 203 SCKST+ AHAW MVIVTAGWDGRIKSFHNYGLP+ Sbjct: 668 SCKSTSSAHAWGMVIVTAGWDGRIKSFHNYGLPI 701 >XP_013461436.1 transducin/WD40 repeat protein [Medicago truncatula] KEH35471.1 transducin/WD40 repeat protein [Medicago truncatula] Length = 702 Score = 69.3 bits (168), Expect = 1e-11 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SCKST AHAW MVIVTAGWDG+IK+F NYGLPVPV Sbjct: 667 SCKSTNSAHAWGMVIVTAGWDGKIKTFQNYGLPVPV 702 >XP_018824711.1 PREDICTED: uncharacterized protein LOC108994078 [Juglans regia] Length = 696 Score = 68.9 bits (167), Expect = 2e-11 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 304 SCKSTTCAHAWVMVIVTAGWDGRIKSFHNYGLPVPV 197 SC++T+ +HAW +VIVTAGWDGRIKSFHNYGLPVP+ Sbjct: 661 SCQNTSSSHAWGLVIVTAGWDGRIKSFHNYGLPVPL 696