BLASTX nr result
ID: Glycyrrhiza28_contig00037210
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037210 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074273983.1 hypothetical protein [Bradyrhizobium erythrophlei] 52 1e-06 >WP_074273983.1 hypothetical protein [Bradyrhizobium erythrophlei] Length = 107 Score = 52.0 bits (123), Expect = 1e-06 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 5/78 (6%) Frame = +2 Query: 20 QASLKTIGKVLGSLDDRASSPISAGT*CARAPSRNE-----RGRTVCETNDIMCISPVRE 184 +ASLK IG VLGSL+ S PI AG + R RGR +C +IM I P Sbjct: 30 RASLKNIGNVLGSLEIGMSGPIRAGGRRGQQRDRKSSTDIGRGRAICVYIEIMQILPGSS 89 Query: 185 TMALLINASCAIGKMTSA 238 ALLINAS G MT+A Sbjct: 90 DDALLINASQVNGNMTTA 107