BLASTX nr result
ID: Glycyrrhiza28_contig00037109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037109 (440 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_006023170.1 MULTISPECIES: hypothetical protein [Rhizobiales] ... 100 4e-24 >WP_006023170.1 MULTISPECIES: hypothetical protein [Rhizobiales] ABS65517.1 hypothetical protein Xaut_0259 [Xanthobacter autotrophicus Py2] ABS67909.1 hypothetical protein Xaut_2668 [Xanthobacter autotrophicus Py2] EKS34559.1 hypothetical protein HMPREF9695_04469 [Afipia broomeae ATCC 49717] Length = 155 Score = 100 bits (248), Expect = 4e-24 Identities = 52/77 (67%), Positives = 53/77 (68%) Frame = +1 Query: 193 MATIALXXXXXXXXXXXXXXSVGTPEYAKTDPTPYLLPATRVHXXXXXXXXXXYAWLGVA 372 MATIAL SVGTPEYAKTDPTPYLLPATRVH YAWLGVA Sbjct: 1 MATIALRTTTTFPAETPRTASVGTPEYAKTDPTPYLLPATRVHPIAIAIPLLAYAWLGVA 60 Query: 373 AWLAFAGGETSLIIAVI 423 AWLAFAGGETSLI+AVI Sbjct: 61 AWLAFAGGETSLILAVI 77