BLASTX nr result
ID: Glycyrrhiza28_contig00037034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037034 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU40524.1 hypothetical protein TSUD_92960 [Trifolium subterraneum] 53 6e-06 >GAU40524.1 hypothetical protein TSUD_92960 [Trifolium subterraneum] Length = 347 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 308 EAQVINCGYRWVIKEDLEMMHR-GRWLSQGCDFLTIEDQAQPQ 183 + +V +CGYRWV K+DL++ H G +L + C FL IED+AQPQ Sbjct: 297 DVKVQSCGYRWVYKQDLQLKHGCGNFLDRKCKFLAIEDEAQPQ 339