BLASTX nr result
ID: Glycyrrhiza28_contig00036931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036931 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006601317.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 75 3e-13 KRH05836.1 hypothetical protein GLYMA_17G251500 [Glycine max] 75 3e-13 XP_006601316.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 75 3e-13 XP_003544406.1 PREDICTED: tubby-like F-box protein 5 [Glycine ma... 71 5e-12 KYP51297.1 Tubby-like F-box protein 5 [Cajanus cajan] 71 5e-12 KHN12701.1 Tubby-like F-box protein 5 [Glycine soja] 71 5e-12 XP_003550385.1 PREDICTED: tubby-like F-box protein 5 isoform X3 ... 71 5e-12 XP_007160744.1 hypothetical protein PHAVU_001G013500g [Phaseolus... 70 2e-11 XP_017430472.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 70 2e-11 XP_004499167.1 PREDICTED: tubby-like F-box protein 5 [Cicer arie... 69 5e-11 XP_014504786.1 PREDICTED: tubby-like F-box protein 5 [Vigna radi... 69 5e-11 XP_019436910.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 67 2e-10 XP_013466123.1 tubby-F-box-like protein [Medicago truncatula] KE... 66 3e-10 XP_019436911.1 PREDICTED: tubby-like F-box protein 5 isoform X2 ... 65 8e-10 XP_003589399.2 tubby-F-box-like protein [Medicago truncatula] AE... 61 3e-09 XP_019458176.1 PREDICTED: tubby-like F-box protein 5 isoform X1 ... 60 3e-08 XP_015947306.1 PREDICTED: tubby-like F-box protein 5 [Arachis du... 55 2e-06 XP_016163210.1 PREDICTED: tubby-like F-box protein 5 [Arachis ip... 54 6e-06 >XP_006601317.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Glycine max] KRH05838.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 448 Score = 74.7 bits (182), Expect = 3e-13 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = +3 Query: 180 LSTPLFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 ++TP+ IM F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 7 ITTPI-IMPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 54 >KRH05836.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 452 Score = 74.7 bits (182), Expect = 3e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +3 Query: 183 STPLFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 ST IM F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 11 STTPIIMPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 58 >XP_006601316.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Glycine max] KRH05837.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 454 Score = 74.7 bits (182), Expect = 3e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +3 Query: 183 STPLFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 ST IM F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 13 STTPIIMPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 60 >XP_003544406.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595928.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595929.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] XP_006595930.1 PREDICTED: tubby-like F-box protein 5 [Glycine max] KHN20970.1 Tubby-like F-box protein 5 [Glycine soja] KRH15179.1 hypothetical protein GLYMA_14G073500 [Glycine max] KRH15180.1 hypothetical protein GLYMA_14G073500 [Glycine max] Length = 423 Score = 71.2 bits (173), Expect = 5e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 42 >KYP51297.1 Tubby-like F-box protein 5 [Cajanus cajan] Length = 424 Score = 71.2 bits (173), Expect = 5e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 42 >KHN12701.1 Tubby-like F-box protein 5 [Glycine soja] Length = 436 Score = 71.2 bits (173), Expect = 5e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 42 >XP_003550385.1 PREDICTED: tubby-like F-box protein 5 isoform X3 [Glycine max] KRH05839.1 hypothetical protein GLYMA_17G251500 [Glycine max] Length = 436 Score = 71.2 bits (173), Expect = 5e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SIVRELKE+GEGI NMYRR GGEAK + HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEAKHV--HRHGKSHIAPEC 42 >XP_007160744.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] XP_007160745.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] ESW32738.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] ESW32739.1 hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] Length = 429 Score = 69.7 bits (169), Expect = 2e-11 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SIVRELKE+GEGI NMYRR GGE K + HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEGKHV--HRHGKSHIAPEC 42 >XP_017430472.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Vigna angularis] KOM49157.1 hypothetical protein LR48_Vigan07g286100 [Vigna angularis] BAT82765.1 hypothetical protein VIGAN_03282400 [Vigna angularis var. angularis] Length = 434 Score = 69.7 bits (169), Expect = 2e-11 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SIVRELKE+GEGI NMYRR GGE K + HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRR-GGEGKHV--HRHGKSHIAPEC 42 >XP_004499167.1 PREDICTED: tubby-like F-box protein 5 [Cicer arietinum] XP_012570834.1 PREDICTED: tubby-like F-box protein 5 [Cicer arietinum] Length = 420 Score = 68.6 bits (166), Expect = 5e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M+ KSIVRE+KEMGEGIGNMYRR G E+K + HRHGKSHIAPEC Sbjct: 1 MSLKSIVREIKEMGEGIGNMYRR-GVESKHM--HRHGKSHIAPEC 42 >XP_014504786.1 PREDICTED: tubby-like F-box protein 5 [Vigna radiata var. radiata] Length = 434 Score = 68.6 bits (166), Expect = 5e-11 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M F+SI+RELKE+GEGI NMYRR GGE K + HRHGKSHIAPEC Sbjct: 1 MPFRSILRELKEIGEGISNMYRR-GGEGKHV--HRHGKSHIAPEC 42 >XP_019436910.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Lupinus angustifolius] Length = 437 Score = 66.6 bits (161), Expect = 2e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +3 Query: 192 LFIMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 L +M+FKSI RELK+MGEGIGNMYR+ G EAK + H +GKSHIAPEC Sbjct: 10 LIMMSFKSIFRELKDMGEGIGNMYRK-GAEAKHM--HLYGKSHIAPEC 54 >XP_013466123.1 tubby-F-box-like protein [Medicago truncatula] KEH40162.1 tubby-F-box-like protein [Medicago truncatula] Length = 422 Score = 66.2 bits (160), Expect = 3e-10 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M FKSIV+ELKEM EGIGNMYRR G E K + HRHGKSHIAPEC Sbjct: 1 MPFKSIVKELKEMKEGIGNMYRR-GVETKHM--HRHGKSHIAPEC 42 >XP_019436911.1 PREDICTED: tubby-like F-box protein 5 isoform X2 [Lupinus angustifolius] Length = 426 Score = 65.1 bits (157), Expect = 8e-10 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 198 IMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 +M+FKSI RELK+MGEGIGNMYR+ G EAK + H +GKSHIAPEC Sbjct: 1 MMSFKSIFRELKDMGEGIGNMYRK-GAEAKHM--HLYGKSHIAPEC 43 >XP_003589399.2 tubby-F-box-like protein [Medicago truncatula] AES59650.2 tubby-F-box-like protein [Medicago truncatula] Length = 159 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +3 Query: 201 MAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 M FKSIVRE+KEM EGIGNMY R + + HRHGKSHIAPEC Sbjct: 1 MPFKSIVREIKEMKEGIGNMYIR---DVETKHTHRHGKSHIAPEC 42 >XP_019458176.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Lupinus angustifolius] XP_019458177.1 PREDICTED: tubby-like F-box protein 5 isoform X1 [Lupinus angustifolius] OIW03497.1 hypothetical protein TanjilG_31010 [Lupinus angustifolius] Length = 424 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +3 Query: 198 IMAFKSIVRELKEMGEGIGNMYRRGGGEAKPIMHHRHGKSHIAPEC 335 +M F++IV ELK++GEGIGNMYR+ G E+K + H HGKSHIAPEC Sbjct: 1 MMPFRTIVYELKDIGEGIGNMYRK-GAESKHM--HWHGKSHIAPEC 43 >XP_015947306.1 PREDICTED: tubby-like F-box protein 5 [Arachis duranensis] Length = 453 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/47 (57%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Frame = +3 Query: 210 KSIVRELKEMGEGIGNMYRRGGGEAKPI-----MHHRHGKSHIAPEC 335 K+IV+ELKE+GE I NMYR HHRHGKSHIAPEC Sbjct: 6 KNIVKELKEIGESISNMYRNNNNNKHNAHHHHHHHHRHGKSHIAPEC 52 >XP_016163210.1 PREDICTED: tubby-like F-box protein 5 [Arachis ipaensis] Length = 455 Score = 53.9 bits (128), Expect = 6e-06 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 5/47 (10%) Frame = +3 Query: 210 KSIVRELKEMGEGIGNMYRRGGGEA--KPIMHH---RHGKSHIAPEC 335 K+IV+ELKE+GE I NMYR K +HH RHGKSHIAPEC Sbjct: 6 KNIVKELKEIGESISNMYRNNNNNNNNKHSVHHHHYRHGKSHIAPEC 52