BLASTX nr result
ID: Glycyrrhiza28_contig00036816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036816 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010112424.1 hypothetical protein L484_006109 [Morus notabilis... 75 2e-16 KRH04013.1 hypothetical protein GLYMA_17G134000 [Glycine max] 55 3e-08 >XP_010112424.1 hypothetical protein L484_006109 [Morus notabilis] EXC33545.1 hypothetical protein L484_006109 [Morus notabilis] Length = 64 Score = 75.1 bits (183), Expect = 2e-16 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = -2 Query: 238 PEPKEGKERTKARSSLAIHSEGGWGSTSFMTHGPSV*LG 122 PEPKEGKE TKARSSLAIHSEG WGSTSFMTHGPSV LG Sbjct: 26 PEPKEGKEWTKARSSLAIHSEGEWGSTSFMTHGPSVSLG 64 >KRH04013.1 hypothetical protein GLYMA_17G134000 [Glycine max] Length = 67 Score = 54.7 bits (130), Expect = 3e-08 Identities = 28/56 (50%), Positives = 32/56 (57%) Frame = -1 Query: 170 MGVNLFHDPWPQCVTWLAFLE*IK*GWFFDRETGELVGCS*DTFFGWTIWISSRWL 3 MGVNLFHDPWP CVTWLAFLE I+ VGCS W + +R+L Sbjct: 1 MGVNLFHDPWPWCVTWLAFLEQIR------------VGCSIGKQGSWLAVVETRFL 44