BLASTX nr result
ID: Glycyrrhiza28_contig00036807
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036807 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU42108.1 hypothetical protein TSUD_350820 [Trifolium subterran... 52 7e-06 >GAU42108.1 hypothetical protein TSUD_350820 [Trifolium subterraneum] Length = 604 Score = 52.4 bits (124), Expect = 7e-06 Identities = 35/68 (51%), Positives = 41/68 (60%), Gaps = 5/68 (7%) Frame = -1 Query: 191 RTEAVWRNVGRTSQSEMIAKPE-NIDLVAEISQLPSPPPP----AVRKMRRGTATKENAA 27 R E V RNV R + E + K E N D VAE S LPSPP P AVRK + + +KENAA Sbjct: 197 RIEDVRRNVERIYEVETVEKSEINDDSVAENSYLPSPPSPPPQPAVRKKKSRSVSKENAA 256 Query: 26 TVASAGFT 3 TV S F+ Sbjct: 257 TVNSVEFS 264