BLASTX nr result
ID: Glycyrrhiza28_contig00036728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036728 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_044587486.1 hypothetical protein [Bradyrhizobium sp. LTSPM299... 55 9e-08 WP_044541096.1 hypothetical protein [Bradyrhizobium sp. LTSP885]... 54 3e-07 >WP_044587486.1 hypothetical protein [Bradyrhizobium sp. LTSPM299] KJC60536.1 hypothetical protein UP10_11580 [Bradyrhizobium sp. LTSPM299] Length = 148 Score = 55.1 bits (131), Expect = 9e-08 Identities = 29/56 (51%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +3 Query: 51 RDLCFHIAGEKYPRVSPQMQCNAA*QSYRFVSRDFGE-SGAPCGEATGATTVSRHH 215 RDLCFHIA KY +QC Q Y+FVS + S CG+ TGA+TVSRHH Sbjct: 2 RDLCFHIADGKYLLTVLMVQCGPVLQRYQFVSGENPRISSFMCGQTTGASTVSRHH 57 >WP_044541096.1 hypothetical protein [Bradyrhizobium sp. LTSP885] KJC39277.1 hypothetical protein UP09_25855 [Bradyrhizobium sp. LTSP885] Length = 148 Score = 53.5 bits (127), Expect = 3e-07 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 51 RDLCFHIAGEKYPRVSPQMQCNAA*QSYRFVSRDFGE-SGAPCGEATGATTVSRHH 215 RDLCFHIA KY MQC Q Y+FVS + S CG TGA+TVSRHH Sbjct: 2 RDLCFHIADGKYLLTVLTMQCCRVQQRYQFVSGENPRISSFICGRPTGASTVSRHH 57