BLASTX nr result
ID: Glycyrrhiza28_contig00036652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036652 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019421497.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 8e-24 OIV94978.1 hypothetical protein TanjilG_22175 [Lupinus angustifo... 102 8e-24 XP_003610808.1 PPR containing plant-like protein [Medicago trunc... 100 4e-23 XP_016187559.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 1e-22 XP_015960897.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 1e-22 KOM41601.1 hypothetical protein LR48_Vigan04g179900 [Vigna angul... 97 7e-22 XP_017421861.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 7e-22 BAT78613.1 hypothetical protein VIGAN_02131300 [Vigna angularis ... 97 7e-22 XP_007157080.1 hypothetical protein PHAVU_002G041300g [Phaseolus... 97 7e-22 KHN35153.1 Pentatricopeptide repeat-containing protein, mitochon... 95 4e-21 XP_006590435.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-21 XP_012574336.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 8e-21 XP_014501497.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 2e-20 XP_006443116.1 hypothetical protein CICLE_v10018682mg [Citrus cl... 87 2e-18 XP_006443117.1 hypothetical protein CICLE_v10018682mg [Citrus cl... 87 2e-18 XP_012078859.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 4e-18 OAY32027.1 hypothetical protein MANES_14G160600 [Manihot esculenta] 86 8e-18 KDO46449.1 hypothetical protein CISIN_1g001911mg [Citrus sinensis] 85 1e-17 XP_018819760.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 2e-17 XP_004140980.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 3e-17 >XP_019421497.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] XP_019421498.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] XP_019421499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] XP_019421500.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] Length = 985 Score = 102 bits (254), Expect = 8e-24 Identities = 48/71 (67%), Positives = 51/71 (71%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDAXXXX 36 FG ET FF QFRGRLSE LV+QVM+HV+NPELCVKFFLWAGRQIGY HTP VYDA Sbjct: 106 FGNETQKFFSQFRGRLSEKLVIQVMDHVQNPELCVKFFLWAGRQIGYAHTPRVYDALLDV 165 Query: 35 XXLGSSGNGND 3 G D Sbjct: 166 MGCGGDDRVRD 176 >OIV94978.1 hypothetical protein TanjilG_22175 [Lupinus angustifolius] Length = 1006 Score = 102 bits (254), Expect = 8e-24 Identities = 48/71 (67%), Positives = 51/71 (71%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDAXXXX 36 FG ET FF QFRGRLSE LV+QVM+HV+NPELCVKFFLWAGRQIGY HTP VYDA Sbjct: 106 FGNETQKFFSQFRGRLSEKLVIQVMDHVQNPELCVKFFLWAGRQIGYAHTPRVYDALLDV 165 Query: 35 XXLGSSGNGND 3 G D Sbjct: 166 MGCGGDDRVRD 176 >XP_003610808.1 PPR containing plant-like protein [Medicago truncatula] AES93766.1 PPR containing plant-like protein [Medicago truncatula] Length = 1084 Score = 100 bits (249), Expect = 4e-23 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYD 51 F IETH FFRQFR +L++SLVV+VMN+VKNPELCVKFFLWAGRQIGY+HTP V+D Sbjct: 89 FNIETHQFFRQFRNQLNDSLVVEVMNNVKNPELCVKFFLWAGRQIGYSHTPQVFD 143 >XP_016187559.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187567.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187574.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187583.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187590.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187599.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187616.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187624.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187630.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] Length = 987 Score = 99.4 bits (246), Expect = 1e-22 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDAXXXX 36 FG +T FRQFRGRL+E+LVVQ+M +V++PELCVKFFLWAGRQIGYTHTPAVYDA Sbjct: 105 FGAQTQKLFRQFRGRLTEALVVQMMCNVRHPELCVKFFLWAGRQIGYTHTPAVYDALLDV 164 Query: 35 XXLGSSG 15 SG Sbjct: 165 LGCNGSG 171 >XP_015960897.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis duranensis] XP_015960902.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis duranensis] Length = 987 Score = 99.4 bits (246), Expect = 1e-22 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDAXXXX 36 FG +T FRQFRGRL+E+LVVQ+M +V++PELCVKFFLWAGRQIGYTHTPAVYDA Sbjct: 105 FGAQTQKLFRQFRGRLTEALVVQMMCNVRHPELCVKFFLWAGRQIGYTHTPAVYDALLDV 164 Query: 35 XXLGSSG 15 SG Sbjct: 165 LGCNGSG 171 >KOM41601.1 hypothetical protein LR48_Vigan04g179900 [Vigna angularis] Length = 958 Score = 97.1 bits (240), Expect = 7e-22 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRG+LSESLVV+VMN VK+P+LCV+FFLWA RQIGYTHTP VY+A Sbjct: 73 FGSETQNFLRQFRGKLSESLVVEVMNLVKHPQLCVEFFLWASRQIGYTHTPVVYNA 128 >XP_017421861.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna angularis] XP_017421862.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna angularis] Length = 970 Score = 97.1 bits (240), Expect = 7e-22 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRG+LSESLVV+VMN VK+P+LCV+FFLWA RQIGYTHTP VY+A Sbjct: 88 FGSETQNFLRQFRGKLSESLVVEVMNLVKHPQLCVEFFLWASRQIGYTHTPVVYNA 143 >BAT78613.1 hypothetical protein VIGAN_02131300 [Vigna angularis var. angularis] Length = 970 Score = 97.1 bits (240), Expect = 7e-22 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRG+LSESLVV+VMN VK+P+LCV+FFLWA RQIGYTHTP VY+A Sbjct: 88 FGSETQNFLRQFRGKLSESLVVEVMNLVKHPQLCVEFFLWASRQIGYTHTPVVYNA 143 >XP_007157080.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] XP_007157081.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] ESW29074.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] ESW29075.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] Length = 970 Score = 97.1 bits (240), Expect = 7e-22 Identities = 45/56 (80%), Positives = 48/56 (85%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRG+LSESLVV+VMN VK PELCV+FFLWA RQIGYTHTP VY A Sbjct: 88 FGSETRNFLRQFRGKLSESLVVEVMNLVKRPELCVEFFLWASRQIGYTHTPVVYTA 143 >KHN35153.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 968 Score = 94.7 bits (234), Expect = 4e-21 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRGRLSE LVV+VMN VK+PE CV+FFLWA RQIGY+HTP VY+A Sbjct: 83 FGAETQNFLRQFRGRLSEPLVVEVMNLVKHPEFCVEFFLWASRQIGYSHTPVVYNA 138 >XP_006590435.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] XP_014619231.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] XP_014619232.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] KRH27688.1 hypothetical protein GLYMA_11G009000 [Glycine max] KRH27689.1 hypothetical protein GLYMA_11G009000 [Glycine max] Length = 968 Score = 94.7 bits (234), Expect = 4e-21 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRGRLSE LVV+VMN VK+PE CV+FFLWA RQIGY+HTP VY+A Sbjct: 83 FGAETQNFLRQFRGRLSEPLVVEVMNLVKHPEFCVEFFLWASRQIGYSHTPVVYNA 138 >XP_012574336.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Cicer arietinum] XP_012574337.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Cicer arietinum] Length = 985 Score = 94.0 bits (232), Expect = 8e-21 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYD 51 F IETH FFRQFR RL+ESLV+ VM++VKNP+LCVKFFLW+GRQIGYTHT V+D Sbjct: 102 FHIETHQFFRQFRTRLNESLVLHVMDNVKNPDLCVKFFLWSGRQIGYTHTHVVFD 156 >XP_014501497.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501498.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501500.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501501.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501502.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501503.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] Length = 970 Score = 92.8 bits (229), Expect = 2e-20 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG ET NF RQFRG+LSESLVV+VMN VK+P+LCV+FFLWA RQIGYTHT VY+A Sbjct: 88 FGSETQNFLRQFRGKLSESLVVEVMNLVKHPQLCVEFFLWARRQIGYTHTHVVYNA 143 >XP_006443116.1 hypothetical protein CICLE_v10018682mg [Citrus clementina] ESR56356.1 hypothetical protein CICLE_v10018682mg [Citrus clementina] Length = 848 Score = 87.0 bits (214), Expect = 2e-18 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG T F RQFR +LSESLVV V+N +KNPEL VKFFLWAGRQIGY+HTP VY+A Sbjct: 115 FGGNTQKFLRQFREKLSESLVVNVLNLIKNPELGVKFFLWAGRQIGYSHTPPVYNA 170 >XP_006443117.1 hypothetical protein CICLE_v10018682mg [Citrus clementina] XP_006478859.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Citrus sinensis] XP_006478860.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Citrus sinensis] ESR56357.1 hypothetical protein CICLE_v10018682mg [Citrus clementina] Length = 997 Score = 87.0 bits (214), Expect = 2e-18 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG T F RQFR +LSESLVV V+N +KNPEL VKFFLWAGRQIGY+HTP VY+A Sbjct: 115 FGGNTQKFLRQFREKLSESLVVNVLNLIKNPELGVKFFLWAGRQIGYSHTPPVYNA 170 >XP_012078859.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Jatropha curcas] XP_012078860.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Jatropha curcas] XP_012078861.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Jatropha curcas] XP_012078862.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Jatropha curcas] Length = 996 Score = 86.3 bits (212), Expect = 4e-18 Identities = 42/71 (59%), Positives = 52/71 (73%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDAXXXX 36 FG +T F RQFR +LSESLV +V+N VKNPEL +KFF+WAGRQIGY+HT AVY+A Sbjct: 110 FGSKTQKFLRQFREKLSESLVAEVLNLVKNPELGIKFFIWAGRQIGYSHTQAVYNA-LLE 168 Query: 35 XXLGSSGNGND 3 ++ N ND Sbjct: 169 MIESTNNNSND 179 >OAY32027.1 hypothetical protein MANES_14G160600 [Manihot esculenta] Length = 1008 Score = 85.5 bits (210), Expect = 8e-18 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG +T F RQ+R +LSE LVV+V+N +KNPEL VKFF+WAGRQIGY+HTP+VY A Sbjct: 123 FGNKTQKFLRQYRQKLSEPLVVEVLNLIKNPELSVKFFIWAGRQIGYSHTPSVYTA 178 >KDO46449.1 hypothetical protein CISIN_1g001911mg [Citrus sinensis] Length = 997 Score = 84.7 bits (208), Expect = 1e-17 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG T F RQFR +LSESLVV V+N +K PEL VKFFLWAGRQIGY+HTP VY+A Sbjct: 115 FGGNTQKFLRQFREKLSESLVVNVLNLIKKPELGVKFFLWAGRQIGYSHTPPVYNA 170 >XP_018819760.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Juglans regia] XP_018819761.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Juglans regia] XP_018819762.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Juglans regia] Length = 1016 Score = 84.3 bits (207), Expect = 2e-17 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDA 48 FG +T F RQFR +L+E+LVV+V+N V+NPEL VKFF+WAGRQIGY HT AVYDA Sbjct: 134 FGDKTQKFLRQFREKLNETLVVEVLNLVQNPELGVKFFIWAGRQIGYKHTKAVYDA 189 >XP_004140980.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Cucumis sativus] Length = 1000 Score = 84.0 bits (206), Expect = 3e-17 Identities = 39/65 (60%), Positives = 48/65 (73%) Frame = -3 Query: 215 FGIETHNFFRQFRGRLSESLVVQVMNHVKNPELCVKFFLWAGRQIGYTHTPAVYDAXXXX 36 FG +TH RQFR +L+ LVV++++ +K+PELCVKFFLWAGRQIGY HTPAVY A Sbjct: 121 FGEKTHIVLRQFRQKLNPDLVVEILSFLKSPELCVKFFLWAGRQIGYDHTPAVYIALLDV 180 Query: 35 XXLGS 21 GS Sbjct: 181 FERGS 185