BLASTX nr result
ID: Glycyrrhiza28_contig00036630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036630 (222 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_061979387.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 81 1e-17 SCB50181.1 hypothetical protein GA0061103_0773 [Rhizobium multih... 73 1e-14 WP_061979386.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 72 1e-13 ACI94789.1 conserved hypothetical protein [Oligotropha carboxido... 68 1e-13 WP_040427726.1 hypothetical protein [Afipia birgiae] 69 4e-13 WP_013913484.1 hypothetical protein [Oligotropha carboxidovorans... 68 1e-12 WP_006023713.1 MULTISPECIES: hypothetical protein [Afipia] EKS32... 67 4e-12 OJV00510.1 hypothetical protein BGO16_07530 [Nitrobacter sp. 62-23] 67 4e-12 WP_002719030.1 hypothetical protein [Afipia felis] EKS26854.1 hy... 67 4e-12 WP_051987386.1 hypothetical protein [Bosea sp. UNC402CLCol] 66 6e-12 WP_044407346.1 MULTISPECIES: hypothetical protein [Bradyrhizobia... 65 1e-11 OCX32492.1 hypothetical protein QU42_02845 [Bradyrhizobium sp. U... 65 2e-11 WP_043854937.1 hypothetical protein, partial [Bradyrhizobium elk... 65 2e-11 WP_034462675.1 hypothetical protein [Afipia sp. P52-10] ETR79424... 65 2e-11 WP_041359650.1 hypothetical protein [Nitrobacter hamburgensis] 63 1e-10 ABE65033.1 hypothetical protein Nham_4449 (plasmid) [Nitrobacter... 63 1e-10 WP_066719693.1 MULTISPECIES: hypothetical protein [Rhizobiales] 57 2e-08 BAV52639.1 Uncharacterized protein MLTONO_p0169 (plasmid) [Mesor... 57 2e-08 WP_069694305.1 hypothetical protein [Bosea vaviloviae] AOO85122.... 56 8e-08 SDR63775.1 hypothetical protein SAMN05519103_09023 [Rhizobiales ... 55 2e-07 >WP_061979387.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 166 Score = 80.9 bits (198), Expect = 1e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY Sbjct: 130 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 166 >SCB50181.1 hypothetical protein GA0061103_0773 [Rhizobium multihospitium] Length = 166 Score = 73.2 bits (178), Expect = 1e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTTEYPT+SRA R DPY+VDISTANGAQRFYFSL+GY Sbjct: 130 CTTEYPTTSRARRDDPYFVDISTANGAQRFYFSLEGY 166 >WP_061979386.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 196 Score = 71.6 bits (174), Expect = 1e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 105 MARARLITFALLSALAATPVLAQVTSSGWFPVPPD 1 MARARLITFALLSALAATPVLAQVTSSGWFPVPPD Sbjct: 1 MARARLITFALLSALAATPVLAQVTSSGWFPVPPD 35 >ACI94789.1 conserved hypothetical protein [Oligotropha carboxidovorans OM5] Length = 63 Score = 68.2 bits (165), Expect = 1e-13 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTT YPT++R R DPYYVDISTANG QRFYFSLQGY Sbjct: 27 CTTTYPTTARDPRGDPYYVDISTANGTQRFYFSLQGY 63 >WP_040427726.1 hypothetical protein [Afipia birgiae] Length = 166 Score = 69.3 bits (168), Expect = 4e-13 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C+TEY T+SRA+RSDPY+VDISTANG QRFYFSL+GY Sbjct: 130 CSTEYSTTSRAVRSDPYFVDISTANGTQRFYFSLKGY 166 >WP_013913484.1 hypothetical protein [Oligotropha carboxidovorans] AEI04690.1 hypothetical protein OCA4_pOC167B01230 (plasmid) [Oligotropha carboxidovorans OM4] AEI08319.1 hypothetical protein OCA5_pOC16701230 (plasmid) [Oligotropha carboxidovorans OM5] Length = 164 Score = 68.2 bits (165), Expect = 1e-12 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTT YPT++R R DPYYVDISTANG QRFYFSLQGY Sbjct: 128 CTTTYPTTARDPRGDPYYVDISTANGTQRFYFSLQGY 164 >WP_006023713.1 MULTISPECIES: hypothetical protein [Afipia] EKS32993.1 hypothetical protein HMPREF9695_05008 [Afipia broomeae ATCC 49717] CEG10534.1 hypothetical protein BN961_03974 [Afipia felis] Length = 163 Score = 66.6 bits (161), Expect = 4e-12 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTT YPT+ R RS+PYYVDIS+ANG QRFYFSLQGY Sbjct: 127 CTTTYPTTPRQRRSEPYYVDISSANGVQRFYFSLQGY 163 >OJV00510.1 hypothetical protein BGO16_07530 [Nitrobacter sp. 62-23] Length = 165 Score = 66.6 bits (161), Expect = 4e-12 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTT YPT+ R RS+PYYVDISTANG+QRFYFSL+GY Sbjct: 129 CTTSYPTTPRDPRSEPYYVDISTANGSQRFYFSLRGY 165 >WP_002719030.1 hypothetical protein [Afipia felis] EKS26854.1 hypothetical protein HMPREF9697_03970 [Afipia felis ATCC 53690] Length = 165 Score = 66.6 bits (161), Expect = 4e-12 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C T YPTS+R RSDPY+VDI++ANGAQRFYFSLQGY Sbjct: 129 CATTYPTSARDSRSDPYFVDINSANGAQRFYFSLQGY 165 >WP_051987386.1 hypothetical protein [Bosea sp. UNC402CLCol] Length = 158 Score = 66.2 bits (160), Expect = 6e-12 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C T YPT+ RA RS+PY+VDI TANGAQRFYFSLQGY Sbjct: 122 CRTRYPTTPRATRSEPYFVDIVTANGAQRFYFSLQGY 158 >WP_044407346.1 MULTISPECIES: hypothetical protein [Bradyrhizobiaceae] KIZ46700.1 hypothetical protein OO17_06340 [Rhodopseudomonas palustris] KQW18085.1 hypothetical protein ASC80_21870 [Afipia sp. Root123D2] Length = 166 Score = 65.5 bits (158), Expect = 1e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C+T YPT++R RSDPYYVDIS+ANG+QRFYFSL+GY Sbjct: 130 CSTTYPTTARDPRSDPYYVDISSANGSQRFYFSLRGY 166 >OCX32492.1 hypothetical protein QU42_02845 [Bradyrhizobium sp. UASWS1016] Length = 164 Score = 65.1 bits (157), Expect = 2e-11 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C+T YPT+ R RS+PYYVDISTA+G+QRFYFSLQGY Sbjct: 128 CSTSYPTTPRDSRSEPYYVDISTASGSQRFYFSLQGY 164 >WP_043854937.1 hypothetical protein, partial [Bradyrhizobium elkanii] KIU53758.1 hypothetical protein QU41_00880, partial [Bradyrhizobium elkanii] Length = 156 Score = 64.7 bits (156), Expect = 2e-11 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C T YPT++R R+DPYYVD STANG QRFYFSLQGY Sbjct: 120 CATTYPTTARDPRNDPYYVDTSTANGTQRFYFSLQGY 156 >WP_034462675.1 hypothetical protein [Afipia sp. P52-10] ETR79424.1 hypothetical protein X566_00470 [Afipia sp. P52-10] Length = 162 Score = 64.7 bits (156), Expect = 2e-11 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CTT YPT+ R R +PYYVDIS+ANG QRFYFSLQGY Sbjct: 126 CTTTYPTTPRQHRKEPYYVDISSANGVQRFYFSLQGY 162 >WP_041359650.1 hypothetical protein [Nitrobacter hamburgensis] Length = 168 Score = 63.2 bits (152), Expect = 1e-10 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CT YPT+ R RSDPY+VDI+TAN +QRFYFSLQGY Sbjct: 132 CTASYPTTPREARSDPYFVDITTANRSQRFYFSLQGY 168 >ABE65033.1 hypothetical protein Nham_4449 (plasmid) [Nitrobacter hamburgensis X14] Length = 169 Score = 63.2 bits (152), Expect = 1e-10 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 CT YPT+ R RSDPY+VDI+TAN +QRFYFSLQGY Sbjct: 133 CTASYPTTPREARSDPYFVDITTANRSQRFYFSLQGY 169 >WP_066719693.1 MULTISPECIES: hypothetical protein [Rhizobiales] Length = 163 Score = 57.4 bits (137), Expect = 2e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C T YP+ R R +PYYVDI+T NG QRFYF+L+GY Sbjct: 127 CQTSYPSQPRQAREEPYYVDITTTNGQQRFYFALKGY 163 >BAV52639.1 Uncharacterized protein MLTONO_p0169 (plasmid) [Mesorhizobium loti] Length = 167 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C YPT R R+DP YVDISTANG QRFYFSL+GY Sbjct: 131 CQVTYPTIPRQPRNDPDYVDISTANGVQRFYFSLRGY 167 >WP_069694305.1 hypothetical protein [Bosea vaviloviae] AOO85122.1 hypothetical protein BHK69_31000 (plasmid) [Bosea vaviloviae] Length = 177 Score = 55.8 bits (133), Expect = 8e-08 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C T YP+ R R +PY+VDI+T NG QRFYF+L+GY Sbjct: 141 CQTSYPSQPRQARDEPYFVDITTGNGQQRFYFALRGY 177 >SDR63775.1 hypothetical protein SAMN05519103_09023 [Rhizobiales bacterium GAS113] Length = 168 Score = 54.7 bits (130), Expect = 2e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 220 CTTEYPTSSRALRSDPYYVDISTANGAQRFYFSLQGY 110 C YPT +R RS+P YVDI+TANG QRFYFSL+ Y Sbjct: 132 CQPTYPTIARKARSEPNYVDIATANGTQRFYFSLKDY 168