BLASTX nr result
ID: Glycyrrhiza28_contig00036544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036544 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM30730.1 hypothetical protein LR48_Vigan01g028500 [Vigna angul... 54 3e-06 >KOM30730.1 hypothetical protein LR48_Vigan01g028500 [Vigna angularis] Length = 311 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +1 Query: 178 VAETVQLEVICVKDASTSPLEETACGSFGRTLC 276 + E + V CVKDASTSPLEETACGSFGRT C Sbjct: 116 IVEIILAGVECVKDASTSPLEETACGSFGRTFC 148