BLASTX nr result
ID: Glycyrrhiza28_contig00036488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036488 (482 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004511793.1 PREDICTED: transcription factor bHLH18-like [Cice... 57 2e-06 >XP_004511793.1 PREDICTED: transcription factor bHLH18-like [Cicer arietinum] Length = 327 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 304 MGLLVKIIAEIQSLHLFVINSSGLPFKDSIIDITV 200 MGLL+KI+ EIQ+LHLFV+NSS LPF DSI+DIT+ Sbjct: 265 MGLLLKILVEIQNLHLFVVNSSVLPFGDSILDITI 299