BLASTX nr result
ID: Glycyrrhiza28_contig00036425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036425 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004505771.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 1e-20 GAU30608.1 hypothetical protein TSUD_62280 [Trifolium subterraneum] 91 1e-19 XP_013456494.1 PPR containing plant-like protein [Medicago trunc... 87 2e-17 OIW08850.1 hypothetical protein TanjilG_16431 [Lupinus angustifo... 63 4e-09 XP_019450963.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 63 4e-09 KYP68351.1 Pentatricopeptide repeat-containing protein At2g21090... 62 5e-09 XP_016173653.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 7e-08 XP_016168745.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 7e-08 XP_016165126.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 7e-08 XP_016165124.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 7e-08 KOM51020.1 hypothetical protein LR48_Vigan08g184700 [Vigna angul... 59 8e-08 XP_007131688.1 hypothetical protein PHAVU_011G033500g [Phaseolus... 59 8e-08 XP_017432092.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 59 8e-08 KRH24253.1 hypothetical protein GLYMA_12G030500 [Glycine max] 59 1e-07 XP_016186835.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 57 4e-07 XP_015951855.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 57 4e-07 XP_014493501.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 57 5e-07 >XP_004505771.1 PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Cicer arietinum] Length = 604 Score = 95.5 bits (236), Expect = 1e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +3 Query: 195 NFKRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 NFKRFKPTDLCIVKPILS +THL EAVSSLDLLHPKGIRLPSRVLATLLR Sbjct: 11 NFKRFKPTDLCIVKPILSSQTHLPEAVSSLDLLHPKGIRLPSRVLATLLR 60 >GAU30608.1 hypothetical protein TSUD_62280 [Trifolium subterraneum] Length = 299 Score = 90.5 bits (223), Expect = 1e-19 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +3 Query: 186 RTPNFKRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 RT NF RFKPTDLCIVKPI+S +THLS+AVSSLDLLHP+GIRLPS VL LLR Sbjct: 8 RTHNFNRFKPTDLCIVKPIISSKTHLSQAVSSLDLLHPRGIRLPSHVLVNLLR 60 >XP_013456494.1 PPR containing plant-like protein [Medicago truncatula] KEH30525.1 PPR containing plant-like protein [Medicago truncatula] Length = 597 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +3 Query: 198 FKRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 FKRFKPTDLCIVKPILS +THLS+AVSSLD+LHP+GIRL S +LATLLR Sbjct: 5 FKRFKPTDLCIVKPILSSKTHLSDAVSSLDVLHPRGIRLSSHILATLLR 53 >OIW08850.1 hypothetical protein TanjilG_16431 [Lupinus angustifolius] Length = 558 Score = 62.8 bits (151), Expect = 4e-09 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 216 TDLCIVKPIL--SPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 T LCIVK +L S R HLS+AVSSLDLLH KGIRLPS +LATLLR Sbjct: 12 THLCIVKSLLNASSRGHLSQAVSSLDLLHQKGIRLPSHILATLLR 56 >XP_019450963.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g21090-like [Lupinus angustifolius] Length = 585 Score = 62.8 bits (151), Expect = 4e-09 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 216 TDLCIVKPIL--SPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 T LCIVK +L S R HLS+AVSSLDLLH KGIRLPS +LATLLR Sbjct: 12 THLCIVKSLLNASSRGHLSQAVSSLDLLHQKGIRLPSHILATLLR 56 >KYP68351.1 Pentatricopeptide repeat-containing protein At2g21090 family [Cajanus cajan] Length = 585 Score = 62.4 bits (150), Expect = 5e-09 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 210 KPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KP++LCIVKP+LS + LS+AVSSLDLL KGIRLPS +LATLLR Sbjct: 9 KPSNLCIVKPLLS-NSSLSDAVSSLDLLRLKGIRLPSHILATLLR 52 >XP_016173653.1 PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Arachis ipaensis] Length = 223 Score = 58.2 bits (139), Expect = 7e-08 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 201 KRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KRFK LCI K +L+ + L EAVSSLD HPKGIRLPSRVLA LLR Sbjct: 14 KRFKSLKLCISKSLLNAPS-LYEAVSSLDHFHPKGIRLPSRVLAILLR 60 >XP_016168745.1 PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Arachis ipaensis] Length = 223 Score = 58.2 bits (139), Expect = 7e-08 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 201 KRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KRFK LCI K +L+ + L EAVSSLD HPKGIRLPSRVLA LLR Sbjct: 14 KRFKSLKLCISKSLLNAPS-LYEAVSSLDHFHPKGIRLPSRVLAILLR 60 >XP_016165126.1 PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Arachis ipaensis] Length = 223 Score = 58.2 bits (139), Expect = 7e-08 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 201 KRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KRFK LCI K +L+ + L EAVSSLD HPKGIRLPSRVLA LLR Sbjct: 14 KRFKSLKLCISKSLLNAPS-LYEAVSSLDHFHPKGIRLPSRVLAILLR 60 >XP_016165124.1 PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Arachis ipaensis] Length = 223 Score = 58.2 bits (139), Expect = 7e-08 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 201 KRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KRFK LCI K +L+ + L EAVSSLD HPKGIRLPSRVLA LLR Sbjct: 14 KRFKSLKLCISKSLLNAPS-LYEAVSSLDHFHPKGIRLPSRVLAILLR 60 >KOM51020.1 hypothetical protein LR48_Vigan08g184700 [Vigna angularis] BAT91059.1 hypothetical protein VIGAN_06236500 [Vigna angularis var. angularis] Length = 549 Score = 58.9 bits (141), Expect = 8e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 213 PTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 P ++CIVKP+ S T LS+AVSSLDLL KGIRLPS +LATLLR Sbjct: 14 PPNICIVKPLFS-NTSLSDAVSSLDLLRLKGIRLPSHILATLLR 56 >XP_007131688.1 hypothetical protein PHAVU_011G033500g [Phaseolus vulgaris] ESW03682.1 hypothetical protein PHAVU_011G033500g [Phaseolus vulgaris] Length = 549 Score = 58.9 bits (141), Expect = 8e-08 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 189 TPNFK-RFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 +P+F R P +LCIVKP+ S ++ LS+AVSSLDLL KGIRLPS + ATLLR Sbjct: 5 SPSFPTRKSPRNLCIVKPLFS-KSSLSDAVSSLDLLRLKGIRLPSHIFATLLR 56 >XP_017432092.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g21090 [Vigna angularis] Length = 568 Score = 58.9 bits (141), Expect = 8e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 213 PTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 P ++CIVKP+ S T LS+AVSSLDLL KGIRLPS +LATLLR Sbjct: 14 PPNICIVKPLFS-NTSLSDAVSSLDLLRLKGIRLPSHILATLLR 56 >KRH24253.1 hypothetical protein GLYMA_12G030500 [Glycine max] Length = 546 Score = 58.5 bits (140), Expect = 1e-07 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 189 TPNFKRFK-PTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 +P+F+ K P +LCIVK +LS LS+AVSSLDLL KGIRLPS VLATLLR Sbjct: 7 SPSFQPLKSPHNLCIVKSLLS-NPSLSDAVSSLDLLRLKGIRLPSHVLATLLR 58 >XP_016186835.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g21090 [Arachis ipaensis] Length = 575 Score = 57.0 bits (136), Expect = 4e-07 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +3 Query: 201 KRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KRFK LCI K +L+ + L +AVSSLD HPKGIRLPSRVLA LLR Sbjct: 14 KRFKSLKLCISKSLLNAPS-LYDAVSSLDHFHPKGIRLPSRVLAILLR 60 >XP_015951855.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g21090-like [Arachis duranensis] Length = 575 Score = 57.0 bits (136), Expect = 4e-07 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +3 Query: 201 KRFKPTDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 KRFK LCI K +L+ + L +AVSSLD HPKGIRLPSRVLA LLR Sbjct: 14 KRFKSLKLCISKSLLNAPS-LYDAVSSLDHFHPKGIRLPSRVLAILLR 60 >XP_014493501.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g21090 [Vigna radiata var. radiata] Length = 581 Score = 56.6 bits (135), Expect = 5e-07 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 189 TPNFKRFKP-TDLCIVKPILSPRTHLSEAVSSLDLLHPKGIRLPSRVLATLLR 344 +P+F K ++CIVKP+ S T LS+AVSSLDLL KGIRLPS +LATLLR Sbjct: 5 SPSFPTRKSHPNICIVKPLFSS-TSLSDAVSSLDLLRLKGIRLPSHILATLLR 56