BLASTX nr result
ID: Glycyrrhiza28_contig00036421
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036421 (352 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489985.1 PREDICTED: probable polygalacturonase At3g15720 [... 115 5e-30 >XP_004489985.1 PREDICTED: probable polygalacturonase At3g15720 [Cicer arietinum] Length = 206 Score = 115 bits (288), Expect = 5e-30 Identities = 54/62 (87%), Positives = 56/62 (90%) Frame = +3 Query: 129 MIKTILSPFDHYPLQL*LGEDFLPCQNPNLKLKQNHSRPQHPNHSYLNLHPPHLNQSTEV 308 MIKTILSPFDHYPLQL LGEDFLP NPNLKLKQN++ PQHPNHSYLNLH PHLNQ TEV Sbjct: 1 MIKTILSPFDHYPLQLELGEDFLPNLNPNLKLKQNNACPQHPNHSYLNLHSPHLNQGTEV 60 Query: 309 RQ 314 RQ Sbjct: 61 RQ 62