BLASTX nr result
ID: Glycyrrhiza28_contig00036400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036400 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_056245854.1 ISAs1 family transposase [Methylobacterium sp. Le... 83 5e-17 WP_069204086.1 hypothetical protein [Sphingomonas panacis] AOH83... 67 4e-11 WP_069203655.1 hypothetical protein [Sphingomonas panacis] AOH83... 67 4e-11 WP_074125865.1 ISAs1 family transposase [Bradyrhizobium sp. NAS9... 62 4e-09 WP_056243835.1 hypothetical protein [Methylobacterium sp. Leaf45... 57 7e-09 WP_071089744.1 hypothetical protein, partial [Rhizobium sp. RSm-... 60 8e-09 AET98898.1 transposase IS4 family protein [Paracoccus sp. M-1] 60 2e-08 WP_057184153.1 ISAs1 family transposase [Caulobacter sp. Root656... 59 2e-08 WP_046001985.1 ISAs1 family transposase, partial [Paracoccus sp.... 59 4e-08 WP_052292516.1 ISAs1 family transposase [Zymomonas mobilis] 59 4e-08 ACJ49206.1 transposase of ISPmar4 [Paracoccus marcusii] 59 4e-08 ACV75868.1 transposase IS4 family protein [Zymomonas mobilis sub... 59 4e-08 WP_015740142.1 ISAs1 family transposase [Zymomonas mobilis] ACV7... 59 4e-08 SDY62872.1 Transposase DDE domain-containing protein, partial [S... 55 6e-08 SEJ35306.1 Transposase DDE domain-containing protein, partial [S... 55 6e-08 SDZ32749.1 Transposase DDE domain-containing protein, partial [S... 55 7e-08 KDZ10531.1 hypothetical protein AB15_5170, partial [Escherichia ... 54 7e-08 SDZ33604.1 Transposase DDE domain-containing protein, partial [S... 55 8e-08 WP_063898196.1 ISAs1 family transposase [Mesorhizobium loti] 58 8e-08 WP_012708792.1 ISAs1 family transposase [Sinorhizobium fredii] Y... 58 8e-08 >WP_056245854.1 ISAs1 family transposase [Methylobacterium sp. Leaf456] KQT50204.1 hypothetical protein ASG52_25790 [Methylobacterium sp. Leaf456] Length = 332 Score = 83.2 bits (204), Expect = 5e-17 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = -2 Query: 269 RRSLDGGPSDEDGPLQTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAF 111 RRS GG S PLQTRYVALS+VL+PAEVLR VR HWSIENDQ+WLLDVAF Sbjct: 267 RRSTQGGTSAGAEPLQTRYVALSRVLNPAEVLRGVRTHWSIENDQYWLLDVAF 319 >WP_069204086.1 hypothetical protein [Sphingomonas panacis] AOH83512.1 hypothetical protein AWL63_05555 [Sphingomonas panacis] Length = 367 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -2 Query: 221 TRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDAI 96 TRY LS+ L P E LRV+RAHW+IEN QHWLLDVAF ED I Sbjct: 273 TRYAILSRFLPPREALRVIRAHWTIENQQHWLLDVAFGEDRI 314 >WP_069203655.1 hypothetical protein [Sphingomonas panacis] AOH83071.1 hypothetical protein AWL63_02865 [Sphingomonas panacis] AOH84230.1 hypothetical protein AWL63_09850 [Sphingomonas panacis] AOH84438.1 hypothetical protein AWL63_11125 [Sphingomonas panacis] AOH84526.1 hypothetical protein AWL63_11650 [Sphingomonas panacis] AOH84643.1 hypothetical protein AWL63_12355 [Sphingomonas panacis] AOH85431.1 hypothetical protein AWL63_17290 [Sphingomonas panacis] Length = 367 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -2 Query: 221 TRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDAI 96 TRY LS+ L P E LRV+RAHW+IEN QHWLLDVAF ED I Sbjct: 273 TRYAILSRFLPPREALRVIRAHWTIENQQHWLLDVAFGEDRI 314 >WP_074125865.1 ISAs1 family transposase [Bradyrhizobium sp. NAS96.2] OKO81733.1 hypothetical protein AC628_06070 [Bradyrhizobium sp. NAS96.2] Length = 366 Score = 61.6 bits (148), Expect = 4e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 221 TRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 TRY+ALS+ L P + +VVRAHWSIEN HW+LDV F EDA Sbjct: 272 TRYIALSRKLSPETMAQVVRAHWSIENQLHWILDVVFDEDA 312 >WP_056243835.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT55043.1 hypothetical protein ASG52_25300 [Methylobacterium sp. Leaf456] Length = 66 Score = 56.6 bits (135), Expect = 7e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 3 QGGLRGVLAQDGESEPAQQGEVLGGRGVASEDGILAEGDV 122 QG GVLAQDGE + AQQGEVL RG+A ED +LAEG+V Sbjct: 21 QGAFGGVLAQDGEGQAAQQGEVLSRRGIAGEDVVLAEGEV 60 >WP_071089744.1 hypothetical protein, partial [Rhizobium sp. RSm-3] OHV21526.1 hypothetical protein BBJ66_31135, partial [Rhizobium sp. RSm-3] Length = 300 Score = 60.5 bits (145), Expect = 8e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 218 RYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFRED 102 RYVALS+VL P ++ VVRAHW+IEN HW+LDV F ED Sbjct: 230 RYVALSKVLTPKKLAEVVRAHWTIENQLHWILDVVFNED 268 >AET98898.1 transposase IS4 family protein [Paracoccus sp. M-1] Length = 349 Score = 59.7 bits (143), Expect = 2e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 224 QTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 +TRY ALS V +PA + VRAHW IEN HW LDV+FREDA Sbjct: 268 ETRYFALSWVREPAAFMAAVRAHWGIENALHWQLDVSFREDA 309 >WP_057184153.1 ISAs1 family transposase [Caulobacter sp. Root656] KRA70455.1 hypothetical protein ASD89_13960 [Caulobacter sp. Root656] Length = 366 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 221 TRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFRED 102 TRY+ LS+ L PA++ +VVRAHWSIEN HW LDV F ED Sbjct: 272 TRYILLSRKLSPAKLAQVVRAHWSIENHLHWTLDVVFDED 311 >WP_046001985.1 ISAs1 family transposase, partial [Paracoccus sp. 228] KIX16123.1 transposase, partial [Paracoccus sp. 228] Length = 355 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 224 QTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 +TRY ALS V P +L VRAHW+IEN HW LDV+FREDA Sbjct: 264 ETRYFALSWVPTPEVLLATVRAHWAIENSLHWQLDVSFREDA 305 >WP_052292516.1 ISAs1 family transposase [Zymomonas mobilis] Length = 380 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 224 QTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 +TRY ALS V P +L VRAHW+IEN HW LDV+FREDA Sbjct: 284 ETRYFALSWVPTPEVLLATVRAHWAIENSLHWQLDVSFREDA 325 >ACJ49206.1 transposase of ISPmar4 [Paracoccus marcusii] Length = 383 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 224 QTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 +TRY ALS V P +L VRAHW+IEN HW LDV+FREDA Sbjct: 284 ETRYFALSWVPTPEVLLATVRAHWAIENSLHWQLDVSFREDA 325 >ACV75868.1 transposase IS4 family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 384 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 224 QTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 +TRY ALS V P +L VRAHW+IEN HW LDV+FREDA Sbjct: 288 ETRYFALSWVPTPEVLLATVRAHWAIENSLHWQLDVSFREDA 329 >WP_015740142.1 ISAs1 family transposase [Zymomonas mobilis] ACV75871.1 transposase IS4 family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 397 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 224 QTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 +TRY ALS V P +L VRAHW+IEN HW LDV+FREDA Sbjct: 301 ETRYFALSWVPTPEVLLATVRAHWAIENSLHWQLDVSFREDA 342 >SDY62872.1 Transposase DDE domain-containing protein, partial [Sinorhizobium meliloti] Length = 95 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -2 Query: 218 RYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 RY LS + P+ ++ VVR HW IEN HW+LDV FREDA Sbjct: 2 RYFLLSTTMSPSALIEVVRTHWQIENKLHWVLDVHFREDA 41 >SEJ35306.1 Transposase DDE domain-containing protein, partial [Sinorhizobium meliloti] Length = 111 Score = 55.5 bits (132), Expect = 6e-08 Identities = 23/40 (57%), Positives = 29/40 (72%) Frame = -2 Query: 218 RYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 RY LS + P+ ++ VVR+HW IEN HW+LDV FREDA Sbjct: 18 RYFLLSTTMSPSALIEVVRSHWQIENKLHWVLDVHFREDA 57 >SDZ32749.1 Transposase DDE domain-containing protein, partial [Sinorhizobium meliloti] Length = 102 Score = 55.1 bits (131), Expect = 7e-08 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -2 Query: 218 RYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 RY LS + P+ ++ VVR HW IEN HW+LDV FREDA Sbjct: 9 RYFLLSTTMSPSALIEVVRTHWQIENKLHWVLDVHFREDA 48 >KDZ10531.1 hypothetical protein AB15_5170, partial [Escherichia coli 3-020-07_S1_C1] Length = 45 Score = 53.5 bits (127), Expect = 7e-08 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -2 Query: 227 LQTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 + T Y S + P + + VR HW IEN QHW+LDVA+REDA Sbjct: 1 MDTHYYVSSLEIAPEQAAKAVRQHWHIENQQHWVLDVAYREDA 43 >SDZ33604.1 Transposase DDE domain-containing protein, partial [Sinorhizobium meliloti] Length = 110 Score = 55.1 bits (131), Expect = 8e-08 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -2 Query: 218 RYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFREDA 99 RY LS + P+ ++ VVR HW IEN HW+LDV FREDA Sbjct: 17 RYFLLSTTMSPSALIEVVRTHWQIENKLHWVLDVHFREDA 56 >WP_063898196.1 ISAs1 family transposase [Mesorhizobium loti] Length = 366 Score = 57.8 bits (138), Expect = 8e-08 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = -2 Query: 248 PSDEDGPLQTRYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFRED 102 P+ RY+ALS+VL P ++ VRAHW+IEN HW LDV F ED Sbjct: 263 PAGGKAAASVRYIALSKVLTPRKLAETVRAHWTIENQLHWSLDVVFHED 311 >WP_012708792.1 ISAs1 family transposase [Sinorhizobium fredii] YP_002824384.1 transposase for insertion sequence NGRIS-17b (plasmid) [Sinorhizobium fredii NGR234] YP_002826787.1 transposase for insertion sequence NGRIS-17a [Sinorhizobium fredii NGR234] ACP23631.1 putative transposase for insertion sequence NGRIS-17b (plasmid) [Sinorhizobium fredii NGR234] ACP26034.1 putative transposase for insertion sequence NGRIS-17a [Sinorhizobium fredii NGR234] Length = 370 Score = 57.8 bits (138), Expect = 8e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 218 RYVALSQVLDPAEVLRVVRAHWSIENDQHWLLDVAFRED 102 RY+ALS+VL P ++ VVRAHW+IEN HW LDV F ED Sbjct: 277 RYIALSKVLAPHKLAEVVRAHWTIENQLHWSLDVVFHED 315