BLASTX nr result
ID: Glycyrrhiza28_contig00036199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036199 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019452251.1 PREDICTED: serine--tRNA ligase-like isoform X1 [L... 62 9e-09 XP_019419668.1 PREDICTED: serine--tRNA ligase-like isoform X1 [L... 59 1e-07 >XP_019452251.1 PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] Length = 481 Score = 62.4 bits (150), Expect = 9e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -2 Query: 393 PNNEAKGASKHVQFNRAAHILTSITKFFGKRNAFWKIGPRIFN 265 P E +GA KHVQ NRA HIL SITKF GK+NA WK G RIF+ Sbjct: 436 PVKEPRGALKHVQVNRAHHILNSITKFIGKKNAAWKFGTRIFS 478 >XP_019419668.1 PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] XP_019419669.1 PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] Length = 481 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -2 Query: 393 PNNEAKGASKHVQFNRAAHILTSITKFFGKRNAFWKIGPRIFN 265 P EAKGA K VQFNRAA +TSIT FF K FWKIG R+FN Sbjct: 436 PVAEAKGALKRVQFNRAASTMTSITSFFEKWKNFWKIGTRLFN 478