BLASTX nr result
ID: Glycyrrhiza28_contig00036110
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00036110 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019449427.1 PREDICTED: cleavage and polyadenylation specifici... 98 5e-21 OIW07871.1 hypothetical protein TanjilG_19972 [Lupinus angustifo... 98 5e-21 KOM54699.1 hypothetical protein LR48_Vigan10g059100 [Vigna angul... 96 9e-21 KHN24410.1 Cleavage and polyadenylation specificity factor subun... 96 2e-20 XP_014512862.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 KRH09221.1 hypothetical protein GLYMA_16G203900 [Glycine max] 96 2e-20 XP_014624439.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_014512856.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_017439837.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_014512849.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_017439836.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_014512842.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_007152397.1 hypothetical protein PHAVU_004G126600g [Phaseolus... 96 2e-20 XP_003548242.1 PREDICTED: cleavage and polyadenylation specifici... 96 2e-20 XP_006587381.1 PREDICTED: cleavage and polyadenylation specifici... 96 3e-20 KHN27846.1 Cleavage and polyadenylation specificity factor subun... 96 3e-20 KYP61845.1 putative cleavage and polyadenylation specificity fac... 96 3e-20 XP_003534039.1 PREDICTED: cleavage and polyadenylation specifici... 96 3e-20 XP_013452453.1 cleavage and polyadenylation specificity factor s... 95 5e-20 XP_016204143.1 PREDICTED: cleavage and polyadenylation specifici... 95 5e-20 >XP_019449427.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 [Lupinus angustifolius] XP_019449428.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 [Lupinus angustifolius] Length = 1451 Score = 97.8 bits (242), Expect = 5e-21 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+LTNLSDLSLGTSFL Sbjct: 1403 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILTNLSDLSLGTSFL 1451 >OIW07871.1 hypothetical protein TanjilG_19972 [Lupinus angustifolius] Length = 1495 Score = 97.8 bits (242), Expect = 5e-21 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+LTNLSDLSLGTSFL Sbjct: 1447 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILTNLSDLSLGTSFL 1495 >KOM54699.1 hypothetical protein LR48_Vigan10g059100 [Vigna angularis] Length = 416 Score = 96.3 bits (238), Expect = 9e-21 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 368 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 416 >KHN24410.1 Cleavage and polyadenylation specificity factor subunit 1 [Glycine soja] Length = 860 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 812 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 860 >XP_014512862.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X4 [Vigna radiata var. radiata] Length = 1217 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1169 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1217 >KRH09221.1 hypothetical protein GLYMA_16G203900 [Glycine max] Length = 1254 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1206 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1254 >XP_014624439.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like isoform X2 [Glycine max] KRH09222.1 hypothetical protein GLYMA_16G203900 [Glycine max] Length = 1265 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1217 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1265 >XP_014512856.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X3 [Vigna radiata var. radiata] Length = 1304 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1256 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1304 >XP_017439837.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X2 [Vigna angularis] Length = 1444 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1396 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1444 >XP_014512849.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X2 [Vigna radiata var. radiata] Length = 1444 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1396 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1444 >XP_017439836.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X1 [Vigna angularis] BAU02451.1 hypothetical protein VIGAN_11198500 [Vigna angularis var. angularis] Length = 1445 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1397 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1445 >XP_014512842.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 isoform X1 [Vigna radiata var. radiata] Length = 1445 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1397 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1445 >XP_007152397.1 hypothetical protein PHAVU_004G126600g [Phaseolus vulgaris] ESW24391.1 hypothetical protein PHAVU_004G126600g [Phaseolus vulgaris] Length = 1445 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1397 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1445 >XP_003548242.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like isoform X1 [Glycine max] KRH09220.1 hypothetical protein GLYMA_16G203900 [Glycine max] Length = 1447 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDLSLGTSFL Sbjct: 1399 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLSLGTSFL 1447 >XP_006587381.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like isoform X2 [Glycine max] Length = 1217 Score = 95.9 bits (237), Expect = 3e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA Q+GTTRSQ+L+NLSDLSLGTSFL Sbjct: 1169 PDSIVDCELLCHYEMLPLEEQLEIANQIGTTRSQILSNLSDLSLGTSFL 1217 >KHN27846.1 Cleavage and polyadenylation specificity factor subunit 1 [Glycine soja] Length = 1286 Score = 95.9 bits (237), Expect = 3e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA Q+GTTRSQ+L+NLSDLSLGTSFL Sbjct: 1238 PDSIVDCELLCHYEMLPLEEQLEIANQIGTTRSQILSNLSDLSLGTSFL 1286 >KYP61845.1 putative cleavage and polyadenylation specificity factor subunit 1 [Cajanus cajan] Length = 1394 Score = 95.9 bits (237), Expect = 3e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA Q+GTTRSQ+L+NLSDLSLGTSFL Sbjct: 1346 PDSIVDCELLCHYEMLPLEEQLEIANQIGTTRSQILSNLSDLSLGTSFL 1394 >XP_003534039.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1-like isoform X1 [Glycine max] KRH38714.1 hypothetical protein GLYMA_09G153100 [Glycine max] Length = 1449 Score = 95.9 bits (237), Expect = 3e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA Q+GTTRSQ+L+NLSDLSLGTSFL Sbjct: 1401 PDSIVDCELLCHYEMLPLEEQLEIANQIGTTRSQILSNLSDLSLGTSFL 1449 >XP_013452453.1 cleavage and polyadenylation specificity factor subunit 1 [Medicago truncatula] KEH26481.1 cleavage and polyadenylation specificity factor subunit 1 [Medicago truncatula] Length = 1448 Score = 95.1 bits (235), Expect = 5e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NL+DLSLGTSFL Sbjct: 1400 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLNDLSLGTSFL 1448 >XP_016204143.1 PREDICTED: cleavage and polyadenylation specificity factor subunit 1 [Arachis ipaensis] Length = 1458 Score = 95.1 bits (235), Expect = 5e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 421 PDSIVDCELLCHYEMLPLEEQLEIAQQVGTTRSQVLTNLSDLSLGTSFL 275 PDSIVDCELLCHYEMLPLEEQLEIA QVGTTRSQ+L+NLSDL+LGTSFL Sbjct: 1410 PDSIVDCELLCHYEMLPLEEQLEIAHQVGTTRSQILSNLSDLALGTSFL 1458