BLASTX nr result
ID: Glycyrrhiza28_contig00035390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035390 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP40229.1 putative LRR receptor-like serine/threonine-protein k... 67 5e-11 XP_019456813.1 PREDICTED: probable receptor-like protein kinase ... 66 2e-10 XP_016181528.1 PREDICTED: probable receptor-like protein kinase ... 66 2e-10 XP_015936986.1 PREDICTED: probable receptor-like protein kinase ... 66 2e-10 XP_013466448.1 receptor-like kinase plant-like protein, putative... 65 7e-10 XP_004498364.1 PREDICTED: probable receptor-like protein kinase ... 64 1e-09 XP_007161464.1 hypothetical protein PHAVU_001G071100g [Phaseolus... 62 4e-09 AFK38830.1 unknown [Medicago truncatula] 60 3e-08 KYP40228.1 putative LRR receptor-like serine/threonine-protein k... 59 5e-08 XP_007161465.1 hypothetical protein PHAVU_001G071200g [Phaseolus... 59 1e-07 GAU34601.1 hypothetical protein TSUD_15160 [Trifolium subterraneum] 59 1e-07 BAT82108.1 hypothetical protein VIGAN_03206600 [Vigna angularis ... 55 1e-07 KHN05183.1 Putative receptor-like protein kinase [Glycine soja] 58 1e-07 XP_017429929.1 PREDICTED: probable receptor-like protein kinase ... 58 2e-07 XP_014504308.1 PREDICTED: probable receptor-like protein kinase ... 58 2e-07 KOM48514.1 hypothetical protein LR48_Vigan07g221800 [Vigna angul... 58 2e-07 XP_006593824.1 PREDICTED: probable receptor-like protein kinase ... 58 2e-07 XP_007161466.1 hypothetical protein PHAVU_001G071300g [Phaseolus... 57 2e-07 XP_007161467.1 hypothetical protein PHAVU_001G071400g [Phaseolus... 57 2e-07 KHN05182.1 Putative receptor-like protein kinase [Glycine soja] 57 5e-07 >KYP40229.1 putative LRR receptor-like serine/threonine-protein kinase RKF3 [Cajanus cajan] Length = 321 Score = 67.4 bits (163), Expect = 5e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHESF+SS LHG+QRSGRSTP+ Sbjct: 273 DIPQLPDRPVPLGHESFQSSFLHGLQRSGRSTPF 306 >XP_019456813.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Lupinus angustifolius] OIW04511.1 hypothetical protein TanjilG_13893 [Lupinus angustifolius] Length = 612 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHESF+SSLL GMQRSGRS+PY Sbjct: 567 DIPELPDRPVPLGHESFQSSLLAGMQRSGRSSPY 600 >XP_016181528.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Arachis ipaensis] Length = 616 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHESFRSSLL G+QRSGRS PY Sbjct: 570 DIPELPDRPVPLGHESFRSSLLFGLQRSGRSMPY 603 >XP_015936986.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Arachis duranensis] Length = 619 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHESFRSSLL G+QRSGRS PY Sbjct: 573 DIPELPDRPVPLGHESFRSSLLFGLQRSGRSMPY 606 >XP_013466448.1 receptor-like kinase plant-like protein, putative [Medicago truncatula] KEH40489.1 receptor-like kinase plant-like protein, putative [Medicago truncatula] Length = 612 Score = 64.7 bits (156), Expect = 7e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIPNLPDRPVPLGHESF+SSLL+GMQ SGRSTPY Sbjct: 567 DIPNLPDRPVPLGHESFQSSLLNGMQ-SGRSTPY 599 >XP_004498364.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Cicer arietinum] Length = 626 Score = 63.9 bits (154), Expect = 1e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHESF+SSL +G+Q SGRSTPY Sbjct: 578 DIPTLPDRPVPLGHESFQSSLFNGLQSSGRSTPY 611 >XP_007161464.1 hypothetical protein PHAVU_001G071100g [Phaseolus vulgaris] ESW33458.1 hypothetical protein PHAVU_001G071100g [Phaseolus vulgaris] Length = 630 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHE+F+SSLLHG+Q SGRS+ Y Sbjct: 582 DIPQLPDRPVPLGHETFQSSLLHGLQSSGRSSAY 615 >AFK38830.1 unknown [Medicago truncatula] Length = 370 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIPNLPDRPVPLGHESF+ LL+GMQ SGRSTPY Sbjct: 325 DIPNLPDRPVPLGHESFQFFLLNGMQ-SGRSTPY 357 >KYP40228.1 putative LRR receptor-like serine/threonine-protein kinase RKF3 [Cajanus cajan] Length = 603 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 +IP LPDRPVPLGH SF+SSLLHG+QRSGRS Sbjct: 570 EIPKLPDRPVPLGHASFQSSLLHGLQRSGRS 600 >XP_007161465.1 hypothetical protein PHAVU_001G071200g [Phaseolus vulgaris] ESW33459.1 hypothetical protein PHAVU_001G071200g [Phaseolus vulgaris] Length = 608 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 D+P LPDRPVPLGH SF+SSLLHG+Q SGRS Sbjct: 570 DVPKLPDRPVPLGHASFQSSLLHGLQESGRS 600 >GAU34601.1 hypothetical protein TSUD_15160 [Trifolium subterraneum] Length = 614 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIPNLPDRPVPLGHESF+SSLL G SGR+TPY Sbjct: 569 DIPNLPDRPVPLGHESFQSSLLQG---SGRTTPY 599 >BAT82108.1 hypothetical protein VIGAN_03206600 [Vigna angularis var. angularis] Length = 78 Score = 54.7 bits (130), Expect = 1e-07 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSG 243 DIP LP+RPVPLGH SF+SS+LHG+QRSG Sbjct: 50 DIPELPERPVPLGHASFQSSVLHGLQRSG 78 >KHN05183.1 Putative receptor-like protein kinase [Glycine soja] Length = 310 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 D+P LPDRPVPLGH SF+SSLLHG+Q SGRS Sbjct: 274 DVPKLPDRPVPLGHASFQSSLLHGLQGSGRS 304 >XP_017429929.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Vigna angularis] Length = 402 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 D+P LPDRPVPLGH SF+SSLLHG+Q SGRS Sbjct: 364 DVPKLPDRPVPLGHASFQSSLLHGLQGSGRS 394 >XP_014504308.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Vigna radiata var. radiata] Length = 402 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 D+P LPDRPVPLGH SF+SSLLHG+Q SGRS Sbjct: 364 DVPKLPDRPVPLGHASFQSSLLHGLQGSGRS 394 >KOM48514.1 hypothetical protein LR48_Vigan07g221800 [Vigna angularis] Length = 608 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 D+P LPDRPVPLGH SF+SSLLHG+Q SGRS Sbjct: 570 DVPKLPDRPVPLGHASFQSSLLHGLQGSGRS 600 >XP_006593824.1 PREDICTED: probable receptor-like protein kinase At1g11050 [Glycine max] KRH17995.1 hypothetical protein GLYMA_13G032000 [Glycine max] Length = 617 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRS 237 D+P LPDRPVPLGH SF+SSLLHG+Q SGRS Sbjct: 581 DVPKLPDRPVPLGHASFQSSLLHGLQGSGRS 611 >XP_007161466.1 hypothetical protein PHAVU_001G071300g [Phaseolus vulgaris] ESW33460.1 hypothetical protein PHAVU_001G071300g [Phaseolus vulgaris] Length = 594 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSG 243 DIP LPDRPVPLGH SF+SSLLHG+QRSG Sbjct: 566 DIPKLPDRPVPLGHASFQSSLLHGLQRSG 594 >XP_007161467.1 hypothetical protein PHAVU_001G071400g [Phaseolus vulgaris] ESW33461.1 hypothetical protein PHAVU_001G071400g [Phaseolus vulgaris] Length = 599 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSG 243 DIP LPDRPVPLGHESF+SSLLHG+ RSG Sbjct: 571 DIPQLPDRPVPLGHESFQSSLLHGLPRSG 599 >KHN05182.1 Putative receptor-like protein kinase [Glycine soja] Length = 600 Score = 56.6 bits (135), Expect = 5e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 329 DIPNLPDRPVPLGHESFRSSLLHGMQRSGRSTPY 228 DIP LPDRPVPLGHESF SSLL G+Q SGRST Y Sbjct: 553 DIPQLPDRPVPLGHESFPSSLLQGLQ-SGRSTAY 585