BLASTX nr result
ID: Glycyrrhiza28_contig00035386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035386 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013455287.1 replication factor-A carboxy-terminal domain prot... 58 1e-07 XP_003605675.1 replication factor-A carboxy-terminal domain prot... 58 1e-07 XP_003605674.2 replication factor-A carboxy-terminal domain prot... 58 1e-07 XP_012567644.1 PREDICTED: uncharacterized protein LOC101506735, ... 57 3e-07 XP_003600272.2 replication factor-A carboxy-terminal domain prot... 57 3e-07 XP_003593181.2 replication factor-A carboxy-terminal domain prot... 55 2e-06 XP_013446466.1 replication factor-A carboxy-terminal domain prot... 55 2e-06 GAU38345.1 hypothetical protein TSUD_395990 [Trifolium subterran... 53 7e-06 >XP_013455287.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] KEH29318.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 417 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFKS 172 +P EI LVN LFKVE K+ +SPRF QS+RVKK+C D II++FK+ Sbjct: 238 LPTEIAALVNCTYLFKVEFKTAISPRFEQSFRVKKVCTDGVIINQFKA 285 >XP_003605675.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES87872.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 480 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFKS 172 +P EI LVN LFKVE K+ +SPRF QS+RVKK+C D II++FK+ Sbjct: 301 LPTEIAALVNCTYLFKVEFKTAISPRFEQSFRVKKVCTDGVIINQFKA 348 >XP_003605674.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES87871.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 560 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFKS 172 +P EI LVN LFKVE K+ +SPRF QS+RVKK+C D II++FK+ Sbjct: 381 LPTEIAALVNCTYLFKVEFKTAISPRFEQSFRVKKVCTDGVIINQFKA 428 >XP_012567644.1 PREDICTED: uncharacterized protein LOC101506735, partial [Cicer arietinum] Length = 613 Score = 57.4 bits (137), Expect = 3e-07 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 4/76 (5%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFKSFSTPSEDA---- 148 VPKEI +LV K++LFK+E K+ V+ F +S+RVKKLC D +II K + + D Sbjct: 482 VPKEIGDLVEKQLLFKIEAKNDVNSNFEKSFRVKKLCGDLDIIKKLRYVAVEKVDVGLDN 541 Query: 147 IVGDVVAQDLMAKFSD 100 + V DL KF + Sbjct: 542 HIEGGVTNDLNNKFEE 557 >XP_003600272.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES70523.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 719 Score = 57.4 bits (137), Expect = 3e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFKS 172 +P EI LVN LFKVE K+ +SPRF QS+RVKK+C D II++FK+ Sbjct: 540 LPTEIGALVNCTYLFKVEFKTAISPRFEQSFRVKKVCTDGVIINQFKA 587 >XP_003593181.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] AES63432.2 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 555 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFK 175 +P EI ++ K LFKVE K +PRF QS+RV+K+CA P++I++FK Sbjct: 387 LPPEIAGIIGKTFLFKVETKVDQNPRFEQSFRVRKICAMPDVINEFK 433 >XP_013446466.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] KEH20493.1 replication factor-A carboxy-terminal domain protein [Medicago truncatula] Length = 555 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEIIDKFK 175 +P EI ++ K LFKVE K +PRF QS+RV+K+CA P++I++FK Sbjct: 387 LPPEIAGIIGKTFLFKVETKVDQNPRFEQSFRVRKICAMPDVINEFK 433 >GAU38345.1 hypothetical protein TSUD_395990 [Trifolium subterraneum] Length = 242 Score = 52.8 bits (125), Expect = 7e-06 Identities = 32/99 (32%), Positives = 52/99 (52%), Gaps = 7/99 (7%) Frame = -2 Query: 315 VPKEIMELVNKEMLFKVEVKSIVSPRFGQSYRVKKLCADPEII-------DKFKSFSTPS 157 +P ++ LV+K LFK+E K+ +PRF QSYRV+K+C D II DK ++ S Sbjct: 41 MPPQLEGLVDKTWLFKIEAKANHNPRFEQSYRVRKICTDAAIIQLLNEKWDKEEAAVRKS 100 Query: 156 EDAIVGDVVAQDLMAKFSDFEDGSQNGSVDPGSFNLDNN 40 ++ + D + D + +G D G+ + DN+ Sbjct: 101 QNVCLSGESEDD--DESDDVTESDDHGGDDDGALSSDND 137