BLASTX nr result
ID: Glycyrrhiza28_contig00035350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035350 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRG92941.1 hypothetical protein GLYMA_20G238800 [Glycine max] KR... 56 3e-07 >KRG92941.1 hypothetical protein GLYMA_20G238800 [Glycine max] KRG92942.1 hypothetical protein GLYMA_20G238800 [Glycine max] Length = 836 Score = 56.2 bits (134), Expect = 3e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = +1 Query: 22 SVTDILFLSFFPVYHHMGREDFLPQSGLKTHKVGTVPHL*RHGTT*LKPQGQDHYK 189 S I F F + HHMGRE FL GLKTHKVG P R LKPQG DHYK Sbjct: 781 SQLQIFFFYHFFLIHHMGREGFLQHLGLKTHKVGPSPTF-RDTVHDLKPQGPDHYK 835