BLASTX nr result
ID: Glycyrrhiza28_contig00035211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035211 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU27830.1 hypothetical protein TSUD_114100 [Trifolium subterran... 65 9e-10 GAU27831.1 hypothetical protein TSUD_114110 [Trifolium subterran... 57 7e-08 XP_003597960.1 transcription cofactor, putative [Medicago trunca... 59 1e-07 XP_003597958.1 transcription cofactor, putative [Medicago trunca... 59 1e-07 XP_003597955.1 transcription cofactor, putative [Medicago trunca... 56 9e-07 XP_004486634.1 PREDICTED: uncharacterized protein LOC101503108 i... 54 2e-06 XP_004486633.1 PREDICTED: uncharacterized protein LOC101503108 i... 54 3e-06 XP_019448071.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 XP_019448070.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 XP_019448069.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 XP_019448068.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 >GAU27830.1 hypothetical protein TSUD_114100 [Trifolium subterraneum] Length = 391 Score = 64.7 bits (156), Expect = 9e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 105 FVYDNVNLNSMDTNNWRPNQGTEPSMDTGDWRGQL 1 F Y +NL SMD NNWRPNQG EP+MDTGDWRGQL Sbjct: 5 FGYLAINLKSMDNNNWRPNQGAEPNMDTGDWRGQL 39 >GAU27831.1 hypothetical protein TSUD_114110 [Trifolium subterraneum] Length = 123 Score = 56.6 bits (135), Expect = 7e-08 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -2 Query: 75 MDTNNWRPNQGTEPSMDTGDWRGQL 1 MD NNWRPNQG EP+MDTGDWRGQL Sbjct: 1 MDNNNWRPNQGAEPNMDTGDWRGQL 25 >XP_003597960.1 transcription cofactor, putative [Medicago truncatula] AES68211.1 transcription cofactor, putative [Medicago truncatula] Length = 566 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 90 VNLNSMDTNNWRPNQGTEPSMDTGDWRGQL 1 VNL SM TNNWRPNQG EP+MDT DWRGQL Sbjct: 37 VNLYSMVTNNWRPNQGAEPNMDTSDWRGQL 66 >XP_003597958.1 transcription cofactor, putative [Medicago truncatula] AES68209.1 transcription cofactor, putative [Medicago truncatula] Length = 576 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 90 VNLNSMDTNNWRPNQGTEPSMDTGDWRGQL 1 VNL SM TNNWRPNQG EP+MDT DWRGQL Sbjct: 37 VNLYSMVTNNWRPNQGAEPNMDTSDWRGQL 66 >XP_003597955.1 transcription cofactor, putative [Medicago truncatula] AES68206.1 transcription cofactor, putative [Medicago truncatula] Length = 1289 Score = 56.2 bits (134), Expect = 9e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -2 Query: 75 MDTNNWRPNQGTEPSMDTGDWRGQL 1 MDTNNWRPNQG EP+MDT DWRGQL Sbjct: 1 MDTNNWRPNQGAEPNMDTSDWRGQL 25 >XP_004486634.1 PREDICTED: uncharacterized protein LOC101503108 isoform X2 [Cicer arietinum] Length = 215 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 90 VNLNSMDTNNWRPNQGTEPSMDTGDWRGQL 1 VNLN M++NNWR NQG EP+MD+ DWRGQL Sbjct: 115 VNLNLMNSNNWRLNQGAEPNMDSSDWRGQL 144 >XP_004486633.1 PREDICTED: uncharacterized protein LOC101503108 isoform X1 [Cicer arietinum] Length = 234 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 90 VNLNSMDTNNWRPNQGTEPSMDTGDWRGQL 1 VNLN M++NNWR NQG EP+MD+ DWRGQL Sbjct: 115 VNLNLMNSNNWRLNQGAEPNMDSSDWRGQL 144 >XP_019448071.1 PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X4 [Lupinus angustifolius] Length = 1141 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 75 MDTNNWRPNQGTEPSMDTGDWRGQL 1 MDT+NWRPNQ TEP+MDT DWRGQL Sbjct: 1 MDTDNWRPNQSTEPNMDTSDWRGQL 25 >XP_019448070.1 PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X3 [Lupinus angustifolius] Length = 1161 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 75 MDTNNWRPNQGTEPSMDTGDWRGQL 1 MDT+NWRPNQ TEP+MDT DWRGQL Sbjct: 1 MDTDNWRPNQSTEPNMDTSDWRGQL 25 >XP_019448069.1 PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X2 [Lupinus angustifolius] Length = 1293 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 75 MDTNNWRPNQGTEPSMDTGDWRGQL 1 MDT+NWRPNQ TEP+MDT DWRGQL Sbjct: 1 MDTDNWRPNQSTEPNMDTSDWRGQL 25 >XP_019448068.1 PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like isoform X1 [Lupinus angustifolius] Length = 1304 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 75 MDTNNWRPNQGTEPSMDTGDWRGQL 1 MDT+NWRPNQ TEP+MDT DWRGQL Sbjct: 1 MDTDNWRPNQSTEPNMDTSDWRGQL 25