BLASTX nr result
ID: Glycyrrhiza28_contig00034722
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034722 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_061979383.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 84 9e-19 SCB50165.1 hypothetical protein GA0061103_0769 [Rhizobium multih... 80 4e-17 WP_002719034.1 hypothetical protein [Afipia felis] EKS26858.1 hy... 76 1e-15 WP_019200160.1 hypothetical protein [Afipia birgiae] 75 3e-15 WP_012564809.1 hypothetical protein [Oligotropha carboxidovorans... 75 5e-15 WP_044407360.1 MULTISPECIES: hypothetical protein [Bradyrhizobia... 70 2e-13 WP_011505109.1 hypothetical protein [Nitrobacter hamburgensis] A... 70 4e-13 WP_058592561.1 hypothetical protein [Staphylococcus sciuri] KTT9... 70 5e-13 WP_006023709.1 MULTISPECIES: hypothetical protein [Afipia] EKS32... 68 2e-12 KIU53392.1 hypothetical protein QU41_01285 [Bradyrhizobium elkanii] 65 2e-11 WP_063928871.1 hypothetical protein, partial [Bradyrhizobium elk... 65 3e-11 OJV00507.1 hypothetical protein BGO16_07510 [Nitrobacter sp. 62-23] 65 3e-11 WP_034462671.1 hypothetical protein [Afipia sp. P52-10] ETR79420... 60 2e-09 WP_038357840.1 hypothetical protein [Bosea sp. UNC402CLCol] 59 5e-09 BAV52635.1 lipoprotein (plasmid) [Mesorhizobium loti] 57 3e-08 SDR63772.1 hypothetical protein SAMN05519103_09020 [Rhizobiales ... 55 3e-07 >WP_061979383.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 180 Score = 84.3 bits (207), Expect = 9e-19 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE Sbjct: 147 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 180 >SCB50165.1 hypothetical protein GA0061103_0769 [Rhizobium multihospitium] Length = 181 Score = 80.1 bits (196), Expect = 4e-17 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPPR+ VAWRNRESSPKDFWWW+PGRPRYE Sbjct: 148 MQPVYPPRSGVAWRNRESSPKDFWWWVPGRPRYE 181 >WP_002719034.1 hypothetical protein [Afipia felis] EKS26858.1 hypothetical protein HMPREF9697_03974 [Afipia felis ATCC 53690] Length = 182 Score = 76.3 bits (186), Expect = 1e-15 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPP T+V WRNRE SPKDFWWW+PGRPRYE Sbjct: 149 MQPVYPPHTAVPWRNRERSPKDFWWWVPGRPRYE 182 >WP_019200160.1 hypothetical protein [Afipia birgiae] Length = 181 Score = 75.5 bits (184), Expect = 3e-15 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPPR+SVAWRNRE SPKDFW WLPGRPRYE Sbjct: 148 MQPVYPPRSSVAWRNRERSPKDFWRWLPGRPRYE 181 >WP_012564809.1 hypothetical protein [Oligotropha carboxidovorans] ACI94785.1 putative lipoprotein [Oligotropha carboxidovorans OM5] AEI04694.1 hypothetical protein OCA4_pOC167B01270 (plasmid) [Oligotropha carboxidovorans OM4] AEI08323.1 hypothetical protein OCA5_pOC16701270 (plasmid) [Oligotropha carboxidovorans OM5] Length = 182 Score = 74.7 bits (182), Expect = 5e-15 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQP+YPPRT+V WRNRE SPKDFWWW+PGR RYE Sbjct: 149 MQPIYPPRTAVPWRNRERSPKDFWWWVPGRSRYE 182 >WP_044407360.1 MULTISPECIES: hypothetical protein [Bradyrhizobiaceae] KIZ46704.1 hypothetical protein OO17_06360 [Rhodopseudomonas palustris] KQW18089.1 hypothetical protein ASC80_21890 [Afipia sp. Root123D2] Length = 182 Score = 70.5 bits (171), Expect = 2e-13 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPPR + WRNRE SP+D WWW+PGRPRYE Sbjct: 149 MQPVYPPRVAAPWRNRERSPQDVWWWVPGRPRYE 182 >WP_011505109.1 hypothetical protein [Nitrobacter hamburgensis] ABE65037.1 conserved hypothetical protein (plasmid) [Nitrobacter hamburgensis X14] Length = 182 Score = 69.7 bits (169), Expect = 4e-13 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPV+PP T+ W NRE+SPKDFWWW+PGRPRYE Sbjct: 149 MQPVHPPLTAAPWFNREASPKDFWWWVPGRPRYE 182 >WP_058592561.1 hypothetical protein [Staphylococcus sciuri] KTT90619.1 hypothetical protein NS44R_14870 [Staphylococcus sciuri] Length = 184 Score = 69.7 bits (169), Expect = 5e-13 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPP +V WRNRE SPKDFW WLPGRPRYE Sbjct: 151 MQPVYPPLAAVPWRNRERSPKDFWGWLPGRPRYE 184 >WP_006023709.1 MULTISPECIES: hypothetical protein [Afipia] EKS32989.1 hypothetical protein HMPREF9695_05004 [Afipia broomeae ATCC 49717] Length = 183 Score = 68.2 bits (165), Expect = 2e-12 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQPVYPPR+ V WRNRE SPKDFW WLPGR RYE Sbjct: 150 MQPVYPPRSVVPWRNRERSPKDFWRWLPGRDRYE 183 >KIU53392.1 hypothetical protein QU41_01285 [Bradyrhizobium elkanii] Length = 174 Score = 65.1 bits (157), Expect = 2e-11 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQ ++PP T+ WRNRE SPKDFWWW+PGR RYE Sbjct: 141 MQSIHPPVTAAPWRNREHSPKDFWWWVPGRSRYE 174 >WP_063928871.1 hypothetical protein, partial [Bradyrhizobium elkanii] Length = 179 Score = 65.1 bits (157), Expect = 3e-11 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQ ++PP T+ WRNRE SPKDFWWW+PGR RYE Sbjct: 146 MQSIHPPVTAAPWRNREHSPKDFWWWVPGRSRYE 179 >OJV00507.1 hypothetical protein BGO16_07510 [Nitrobacter sp. 62-23] Length = 182 Score = 65.1 bits (157), Expect = 3e-11 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQ ++PP T+ WRNRE SPKDFWWW+PGR RYE Sbjct: 149 MQSIHPPVTAAPWRNREHSPKDFWWWVPGRSRYE 182 >WP_034462671.1 hypothetical protein [Afipia sp. P52-10] ETR79420.1 hypothetical protein X566_00450 [Afipia sp. P52-10] Length = 180 Score = 60.5 bits (145), Expect = 2e-09 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQP+ PPR++V WRNRE SP DFW W PGR RYE Sbjct: 147 MQPIDPPRSAVPWRNRERSPTDFWKWWPGRDRYE 180 >WP_038357840.1 hypothetical protein [Bosea sp. UNC402CLCol] Length = 186 Score = 59.3 bits (142), Expect = 5e-09 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQP+ PPR VAWR+RE SP+D W WLPGR RY+ Sbjct: 153 MQPLEPPRAPVAWRDREGSPRDIWRWLPGRSRYQ 186 >BAV52635.1 lipoprotein (plasmid) [Mesorhizobium loti] Length = 170 Score = 57.0 bits (136), Expect = 3e-08 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 MQ VYPP T+V WR E SP D WWW+PGR RY+ Sbjct: 137 MQTVYPPVTAVPWRTGEHSPTDRWWWVPGRSRYQ 170 >SDR63772.1 hypothetical protein SAMN05519103_09020 [Rhizobiales bacterium GAS113] Length = 185 Score = 54.7 bits (130), Expect = 3e-07 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +3 Query: 3 MQPVYPPRTSVAWRNRESSPKDFWWWLPGRPRYE 104 M+ PPR+ V WR +E SPKD WWW+PGR RYE Sbjct: 152 MRVTDPPRSIVPWRGQEHSPKDSWWWVPGRNRYE 185