BLASTX nr result
ID: Glycyrrhiza28_contig00034719
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034719 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012575082.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 2e-27 XP_014495112.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 9e-26 XP_003525932.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 1e-25 XP_004488535.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 4e-25 BAT79757.1 hypothetical protein VIGAN_02268600 [Vigna angularis ... 105 6e-25 XP_017420183.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 6e-25 XP_007138308.1 hypothetical protein PHAVU_009G197700g [Phaseolus... 105 6e-25 GAU51117.1 hypothetical protein TSUD_281370 [Trifolium subterran... 101 9e-25 XP_019418100.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 7e-23 XP_013443472.1 PPR containing plant-like protein [Medicago trunc... 95 4e-21 XP_016195013.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 2e-18 XP_009344863.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-17 XP_018847219.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-17 XP_008242855.2 PREDICTED: pentatricopeptide repeat-containing pr... 85 2e-17 XP_015959097.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 3e-17 ONH98314.1 hypothetical protein PRUPE_7G242300 [Prunus persica] 84 4e-17 XP_007202004.1 hypothetical protein PRUPE_ppa021060mg, partial [... 84 4e-17 XP_015901781.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 7e-17 XP_017182977.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 3e-16 XP_017178281.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 3e-16 >XP_012575082.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 307 Score = 109 bits (273), Expect = 2e-27 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCRI H+PY+LAP++SVAATSND SFFSYA SIFLHLTHRNTF+HNTMIR Sbjct: 42 KQLHAHILRCRIQHAPYSLAPIISVAATSNDMSFFSYAHSIFLHLTHRNTFIHNTMIR 99 >XP_014495112.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vigna radiata var. radiata] Length = 524 Score = 108 bits (269), Expect = 9e-26 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCR NH+PYALAPLLS AATS+DASFFSYA SIF HLTHRNTFM+NTMIR Sbjct: 22 KQLHAHILRCRYNHTPYALAPLLSAAATSSDASFFSYACSIFRHLTHRNTFMYNTMIR 79 >XP_003525932.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] KRH54973.1 hypothetical protein GLYMA_06G222600 [Glycine max] KRH54974.1 hypothetical protein GLYMA_06G222600 [Glycine max] Length = 526 Score = 107 bits (268), Expect = 1e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCRIN +PYALAPLLSV ATSNDASFFSYA SIF HLT+RNTFMHNTMIR Sbjct: 22 KQLHAHILRCRINDTPYALAPLLSVLATSNDASFFSYARSIFRHLTNRNTFMHNTMIR 79 >XP_004488535.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cicer arietinum] Length = 549 Score = 106 bits (265), Expect = 4e-25 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHA ILRCRI H+PY+LAP++SVAATSND SFFSYA SIFLHLTHRNTF+HNTMIR Sbjct: 42 KQLHAQILRCRIQHAPYSLAPIISVAATSNDMSFFSYAHSIFLHLTHRNTFIHNTMIR 99 >BAT79757.1 hypothetical protein VIGAN_02268600 [Vigna angularis var. angularis] Length = 503 Score = 105 bits (263), Expect = 6e-25 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCR NH+PYALAPLLS AATS+DASFF YA SIF HLTHRNTFM+NTMIR Sbjct: 22 KQLHAHILRCRYNHAPYALAPLLSAAATSSDASFFLYARSIFRHLTHRNTFMYNTMIR 79 >XP_017420183.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vigna angularis] KOM40177.1 hypothetical protein LR48_Vigan04g037500 [Vigna angularis] Length = 521 Score = 105 bits (263), Expect = 6e-25 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCR NH+PYALAPLLS AATS+DASFF YA SIF HLTHRNTFM+NTMIR Sbjct: 22 KQLHAHILRCRYNHAPYALAPLLSAAATSSDASFFLYARSIFRHLTHRNTFMYNTMIR 79 >XP_007138308.1 hypothetical protein PHAVU_009G197700g [Phaseolus vulgaris] ESW10302.1 hypothetical protein PHAVU_009G197700g [Phaseolus vulgaris] Length = 523 Score = 105 bits (263), Expect = 6e-25 Identities = 51/58 (87%), Positives = 52/58 (89%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCR N +PYALAPLLSVAA SNDASFFSYA SIF HL HRNTFMHNTMIR Sbjct: 22 KQLHAHILRCRYNDTPYALAPLLSVAAISNDASFFSYARSIFRHLRHRNTFMHNTMIR 79 >GAU51117.1 hypothetical protein TSUD_281370 [Trifolium subterraneum] Length = 244 Score = 101 bits (252), Expect = 9e-25 Identities = 49/58 (84%), Positives = 52/58 (89%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRCRI HSPYALAPL SVAATSN +SFFSYA SIF +LTH NTF+HNTMIR Sbjct: 21 KQLHAHILRCRIQHSPYALAPLFSVAATSNISSFFSYACSIFHNLTHSNTFIHNTMIR 78 >XP_019418100.1 PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Lupinus angustifolius] OIV96179.1 hypothetical protein TanjilG_14856 [Lupinus angustifolius] Length = 532 Score = 100 bits (248), Expect = 7e-23 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQLHAHILRC I H+PYA+APLLSV+ATSNDASFFSYA S+F +LT RNTFM+NTMIR Sbjct: 25 KQLHAHILRCHIIHTPYAIAPLLSVSATSNDASFFSYAHSVFSNLTRRNTFMYNTMIR 82 >XP_013443472.1 PPR containing plant-like protein [Medicago truncatula] KEH17497.1 PPR containing plant-like protein [Medicago truncatula] Length = 533 Score = 95.1 bits (235), Expect = 4e-21 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 2/60 (3%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTH--RNTFMHNTMIR 174 KQLHAHILRC I HSPYALAP+LSVAATSN SFF YA SIF +LTH RNTF+HNTMIR Sbjct: 21 KQLHAHILRCHIQHSPYALAPILSVAATSNYTSFFLYARSIFHNLTHRNRNTFIHNTMIR 80 >XP_016195013.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Arachis ipaensis] Length = 525 Score = 87.4 bits (215), Expect = 2e-18 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 2/60 (3%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIF--LHLTHRNTFMHNTMIR 174 KQLHAHILRCR+ H+P+A+APLLS AA+SN FSYA SIF LHL HRNTFM+NTMIR Sbjct: 26 KQLHAHILRCRVKHTPFAIAPLLSAAASSN---HFSYAHSIFSTLHLVHRNTFMYNTMIR 82 >XP_009344863.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like, partial [Pyrus x bretschneideri] Length = 158 Score = 81.3 bits (199), Expect = 1e-17 Identities = 41/59 (69%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFL-HLTHRNTFMHNTMIR 174 KQ+HAHIL CR+ + YA+APLLS AATS DASF SYA SIF H HRN FM+NTMIR Sbjct: 25 KQIHAHILTCRLPENLYAIAPLLSAAATSKDASFLSYACSIFKHHHNHRNIFMYNTMIR 83 >XP_018847219.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Juglans regia] Length = 529 Score = 85.5 bits (210), Expect = 1e-17 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQ+HAH+L+ + +PYA+APLLS+AATSNDASF SYA S+F H HRN F++NTMIR Sbjct: 25 KQIHAHLLKSHLPVNPYAIAPLLSIAATSNDASFLSYARSVFEHFRHRNIFLYNTMIR 82 >XP_008242855.2 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 528 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/58 (67%), Positives = 47/58 (81%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQ++AH+L CR+ +PYA+APLLS +ATS DAS F YA SIF H HRNTFM+NTMIR Sbjct: 25 KQIYAHLLTCRLPENPYAIAPLLSASATSKDASLFCYACSIFKHHHHRNTFMYNTMIR 82 >XP_015959097.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Arachis duranensis] Length = 526 Score = 84.3 bits (207), Expect = 3e-17 Identities = 43/60 (71%), Positives = 49/60 (81%), Gaps = 2/60 (3%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFL--HLTHRNTFMHNTMIR 174 KQLHAHILRCR+ H+P+A+APLLS AA+SN FSYA SIF HL HRNTFM+NTMIR Sbjct: 26 KQLHAHILRCRVKHTPFAIAPLLSAAASSN---HFSYAYSIFSTHHLIHRNTFMYNTMIR 82 >ONH98314.1 hypothetical protein PRUPE_7G242300 [Prunus persica] Length = 528 Score = 84.0 bits (206), Expect = 4e-17 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQ++AH+L CR+ +PY++APLLS +ATS DAS F YA SIF H HRNTFM+NTMIR Sbjct: 25 KQIYAHLLTCRLPENPYSIAPLLSASATSKDASLFCYACSIFKHHHHRNTFMYNTMIR 82 >XP_007202004.1 hypothetical protein PRUPE_ppa021060mg, partial [Prunus persica] Length = 554 Score = 84.0 bits (206), Expect = 4e-17 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQ++AH+L CR+ +PY++APLLS +ATS DAS F YA SIF H HRNTFM+NTMIR Sbjct: 51 KQIYAHLLTCRLPENPYSIAPLLSASATSKDASLFCYACSIFKHHHHRNTFMYNTMIR 108 >XP_015901781.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ziziphus jujuba] Length = 527 Score = 83.2 bits (204), Expect = 7e-17 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFLHLTHRNTFMHNTMIR 174 KQ+HAH+L RI +PYA+APLLS A TS +ASFFSYA SIF L HRNTFM+N+MIR Sbjct: 25 KQIHAHLLISRIPQNPYAIAPLLSAAVTSGNASFFSYARSIFDRLLHRNTFMYNSMIR 82 >XP_017182977.1 PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Malus domestica] Length = 494 Score = 81.3 bits (199), Expect = 3e-16 Identities = 41/59 (69%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFL-HLTHRNTFMHNTMIR 174 KQ+HAHIL CR+ + YA+APLLS AATS DASF SYA SIF H HRN FM+NTMIR Sbjct: 25 KQIHAHILTCRLPENLYAIAPLLSAAATSKDASFLSYACSIFKHHHNHRNIFMYNTMIR 83 >XP_017178281.1 PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Malus domestica] Length = 494 Score = 81.3 bits (199), Expect = 3e-16 Identities = 41/59 (69%), Positives = 46/59 (77%), Gaps = 1/59 (1%) Frame = +1 Query: 1 KQLHAHILRCRINHSPYALAPLLSVAATSNDASFFSYASSIFL-HLTHRNTFMHNTMIR 174 KQ+HAHIL CR+ + YA+APLLS AATS DASF SYA SIF H HRN FM+NTMIR Sbjct: 25 KQIHAHILTCRLPENLYAIAPLLSAAATSKDASFLSYACSIFKHHHNHRNIFMYNTMIR 83