BLASTX nr result
ID: Glycyrrhiza28_contig00034689
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034689 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP56001.1 Putative ribonuclease H protein At1g65750 family, par... 52 5e-06 >KYP56001.1 Putative ribonuclease H protein At1g65750 family, partial [Cajanus cajan] Length = 414 Score = 52.4 bits (124), Expect = 5e-06 Identities = 18/33 (54%), Positives = 25/33 (75%) Frame = +3 Query: 72 WSSVWKLHVTEKVRFFVWLAWHDSLPTMHVLEK 170 W +WK+H E ++FF+WLAWHDS+PT +L K Sbjct: 98 WLWIWKIHAPENIKFFLWLAWHDSIPTSSLLFK 130