BLASTX nr result
ID: Glycyrrhiza28_contig00034581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034581 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU25760.1 hypothetical protein TSUD_222170 [Trifolium subterran... 60 7e-08 >GAU25760.1 hypothetical protein TSUD_222170 [Trifolium subterraneum] Length = 574 Score = 59.7 bits (143), Expect = 7e-08 Identities = 31/43 (72%), Positives = 32/43 (74%) Frame = -1 Query: 135 MEHLARSARAWRLRFRSLPSIQTLTSHSSRSIPRSLYPKSVSA 7 M+HL RSAR WRLRFRS PS QTLTSHS R I SL PK SA Sbjct: 1 MKHLLRSARTWRLRFRSAPSSQTLTSHSFRRIHSSLSPKVESA 43