BLASTX nr result
ID: Glycyrrhiza28_contig00034440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034440 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAU94133.1 hypothetical protein MPPM_5528 (plasmid) [Methylobact... 92 3e-22 WP_043768335.1 hypothetical protein [Methylobacterium extorquens] 92 6e-22 OHV18069.1 hypothetical protein BK022_01785 [Methylobacterium ex... 91 2e-21 ACS44153.1 conserved hypothetical protein (plasmid) [Methylobact... 92 4e-21 OHV14619.1 hypothetical protein BK022_25225 [Methylobacterium ex... 90 4e-21 WP_076641508.1 hypothetical protein [Methylobacterium extorquens... 87 4e-20 WP_007558558.1 hypothetical protein [Methylobacterium sp. GXF4] ... 87 5e-20 WP_017482494.1 hypothetical protein [Methylobacterium sp. MB200] 86 1e-19 WP_050736109.1 hypothetical protein [Methylobacterium sp. ARG-1]... 85 3e-19 WP_012779277.1 hypothetical protein [Methylobacterium extorquens... 84 4e-19 AGO88402.1 protein of unassigned function (plasmid) [Methylobact... 82 5e-18 WP_076729723.1 hypothetical protein [Methylobacterium radiotoler... 81 7e-18 WP_012457147.1 hypothetical protein [Methylobacterium populi] AC... 78 1e-16 WP_075382274.1 hypothetical protein [Methylobacterium phyllospha... 75 2e-15 WP_056116220.1 hypothetical protein [Methylobacterium sp. Leaf12... 74 4e-15 WP_026605562.1 hypothetical protein [Methylocapsa acidiphila] 72 2e-14 WP_036262893.1 hypothetical protein [Methylocapsa aurea] 70 2e-13 KOX56767.1 hypothetical protein ADL14_20120 [Asanoa ferruginea] 69 3e-13 WP_053621745.1 hypothetical protein [Asanoa ferruginea] 69 4e-13 WP_066918478.1 hypothetical protein [Methylobacterium sp. CCH5-D2] 67 2e-12 >BAU94133.1 hypothetical protein MPPM_5528 (plasmid) [Methylobacterium populi] Length = 150 Score = 92.4 bits (228), Expect = 3e-22 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF*SAD 105 LCQRCHILHDR EHLRQRWFTYRHRKALGDLFLGPYPFR+ +D Sbjct: 107 LCQRCHILHDRTEHLRQRWFTYRHRKALGDLFLGPYPFRYMRSD 150 >WP_043768335.1 hypothetical protein [Methylobacterium extorquens] Length = 146 Score = 91.7 bits (226), Expect = 6e-22 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDR EHLRQRWFTYRHRKALGDLFLGPYPFR+ Sbjct: 107 LCQRCHILHDRTEHLRQRWFTYRHRKALGDLFLGPYPFRY 146 >OHV18069.1 hypothetical protein BK022_01785 [Methylobacterium extorquens] Length = 150 Score = 90.5 bits (223), Expect = 2e-21 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 LCQRCHILHDR EHLRQRWFTYRHRKALGDLFLGPYPFR Sbjct: 107 LCQRCHILHDRTEHLRQRWFTYRHRKALGDLFLGPYPFR 145 >ACS44153.1 conserved hypothetical protein (plasmid) [Methylobacterium extorquens AM1] Length = 222 Score = 91.7 bits (226), Expect = 4e-21 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDR EHLRQRWFTYRHRKALGDLFLGPYPFR+ Sbjct: 183 LCQRCHILHDRTEHLRQRWFTYRHRKALGDLFLGPYPFRY 222 >OHV14619.1 hypothetical protein BK022_25225 [Methylobacterium extorquens] Length = 150 Score = 89.7 bits (221), Expect = 4e-21 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCH+LHDR EHLRQRWFTYRHR+ALGDLFLGPYPFR+ Sbjct: 107 LCQRCHLLHDRTEHLRQRWFTYRHRRALGDLFLGPYPFRY 146 >WP_076641508.1 hypothetical protein [Methylobacterium extorquens] APX84413.1 hypothetical protein BV511_06570 [Methylobacterium extorquens] Length = 145 Score = 87.0 bits (214), Expect = 4e-20 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 LCQRCHILHDR EHLRQRWFTYRHRKALGDLFLGPYP R Sbjct: 107 LCQRCHILHDRPEHLRQRWFTYRHRKALGDLFLGPYPTR 145 >WP_007558558.1 hypothetical protein [Methylobacterium sp. GXF4] EIZ86844.1 hypothetical protein WYO_0493 [Methylobacterium sp. GXF4] Length = 146 Score = 86.7 bits (213), Expect = 5e-20 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDRAEH RQRWFTYR RKALGDLFLGPYPFR+ Sbjct: 107 LCQRCHILHDRAEHQRQRWFTYRVRKALGDLFLGPYPFRY 146 >WP_017482494.1 hypothetical protein [Methylobacterium sp. MB200] Length = 146 Score = 85.9 bits (211), Expect = 1e-19 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDRAEHLRQRWFTYR R+A GDLFLGPYPFR+ Sbjct: 107 LCQRCHILHDRAEHLRQRWFTYRARRASGDLFLGPYPFRY 146 >WP_050736109.1 hypothetical protein [Methylobacterium sp. ARG-1] KNY19579.1 hypothetical protein AKJ13_27155 [Methylobacterium sp. ARG-1] Length = 146 Score = 84.7 bits (208), Expect = 3e-19 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDR EH RQRWFTYR RKALGDLFLGPYPFR+ Sbjct: 107 LCQRCHILHDREEHQRQRWFTYRVRKALGDLFLGPYPFRY 146 >WP_012779277.1 hypothetical protein [Methylobacterium extorquens] CAX17137.1 conserved hypothetical protein (plasmid) [Methylobacterium extorquens DM4] BAU94119.1 hypothetical protein MPPM_5514 (plasmid) [Methylobacterium populi] Length = 146 Score = 84.3 bits (207), Expect = 4e-19 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDR EHLRQRWFTYR R+A GDLFLGPYPFR+ Sbjct: 107 LCQRCHILHDRTEHLRQRWFTYRARRASGDLFLGPYPFRY 146 >AGO88402.1 protein of unassigned function (plasmid) [Methylobacterium oryzae CBMB20] Length = 146 Score = 81.6 bits (200), Expect = 5e-18 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 LCQRCHILHDR EH RQRW TYR RKALGDLFLGPYPFR+ Sbjct: 107 LCQRCHILHDRDEHRRQRWVTYRVRKALGDLFLGPYPFRY 146 >WP_076729723.1 hypothetical protein [Methylobacterium radiotolerans] ONF47364.1 hypothetical protein RSM1_19950 [Methylobacterium radiotolerans] Length = 146 Score = 81.3 bits (199), Expect = 7e-18 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 233 CQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 CQRCHILHDR EHLRQRW TYR RKA+GDLFLGPYPFR+ Sbjct: 108 CQRCHILHDRDEHLRQRWVTYRVRKAVGDLFLGPYPFRY 146 >WP_012457147.1 hypothetical protein [Methylobacterium populi] ACB83526.1 conserved hypothetical protein (plasmid) [Methylobacterium populi BJ001] Length = 145 Score = 78.2 bits (191), Expect = 1e-16 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 LCQRCHILHDRAEHLRQR TYR RKALGDLFLGPYP R Sbjct: 107 LCQRCHILHDRAEHLRQRQLTYRLRKALGDLFLGPYPLR 145 >WP_075382274.1 hypothetical protein [Methylobacterium phyllosphaerae] SFH68556.1 hypothetical protein SAMN05192567_14414 [Methylobacterium phyllosphaerae] APT35134.1 hypothetical protein MCBMB27_05843 (plasmid) [Methylobacterium phyllosphaerae] Length = 150 Score = 75.1 bits (183), Expect = 2e-15 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 LCQRCHILHDR EHLRQRW TYR RKA GDLFLGPY R Sbjct: 107 LCQRCHILHDREEHLRQRWLTYRLRKARGDLFLGPYTAR 145 >WP_056116220.1 hypothetical protein [Methylobacterium sp. Leaf122] KQQ17617.1 hypothetical protein ASF56_23130 [Methylobacterium sp. Leaf122] Length = 145 Score = 74.3 bits (181), Expect = 4e-15 Identities = 34/39 (87%), Positives = 34/39 (87%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 LCQRCHILHDR EHLRQR TYR RKALGDLFLGPYP R Sbjct: 107 LCQRCHILHDRPEHLRQRRLTYRLRKALGDLFLGPYPPR 145 >WP_026605562.1 hypothetical protein [Methylocapsa acidiphila] Length = 143 Score = 72.4 bits (176), Expect = 2e-14 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPF 123 LCQRCH+LHDR EH RQRW T R RKALGDLFLGPY F Sbjct: 105 LCQRCHLLHDRDEHRRQRWLTLRMRKALGDLFLGPYKF 142 >WP_036262893.1 hypothetical protein [Methylocapsa aurea] Length = 143 Score = 70.1 bits (170), Expect = 2e-13 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 236 LCQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPF 123 LCQRCH+ HDR EH RQRW T R RKALGDLFLGPY F Sbjct: 105 LCQRCHLRHDRDEHRRQRWLTLRMRKALGDLFLGPYKF 142 >KOX56767.1 hypothetical protein ADL14_20120 [Asanoa ferruginea] Length = 128 Score = 68.9 bits (167), Expect = 3e-13 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 233 CQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 CQRCH++HDR EHLR+R TY R+ALGDLFLGPYP R Sbjct: 91 CQRCHLIHDRPEHLRRRQLTYLRRRALGDLFLGPYPLR 128 >WP_053621745.1 hypothetical protein [Asanoa ferruginea] Length = 143 Score = 68.9 bits (167), Expect = 4e-13 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 233 CQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 CQRCH++HDR EHLR+R TY R+ALGDLFLGPYP R Sbjct: 106 CQRCHLIHDRPEHLRRRQLTYLRRRALGDLFLGPYPLR 143 >WP_066918478.1 hypothetical protein [Methylobacterium sp. CCH5-D2] Length = 143 Score = 67.4 bits (163), Expect = 2e-12 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 233 CQRCHILHDRAEHLRQRWFTYRHRKALGDLFLGPYP 126 CQRCH+LHDR EHLR+R TY R+ALGDLFLGPYP Sbjct: 106 CQRCHLLHDRPEHLRRRRLTYLRRRALGDLFLGPYP 141