BLASTX nr result
ID: Glycyrrhiza28_contig00034339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034339 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507153.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 1e-22 XP_013456164.1 PPR containing plant-like protein [Medicago trunc... 82 4e-17 XP_003537970.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 4e-15 XP_019454098.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-14 KYP37127.1 Pentatricopeptide repeat-containing protein At3g46870... 72 2e-13 XP_006591821.1 PREDICTED: uncharacterized protein LOC100306428 i... 69 2e-12 GAU45009.1 hypothetical protein TSUD_88000 [Trifolium subterraneum] 66 2e-11 XP_007132030.1 hypothetical protein PHAVU_011G060800g [Phaseolus... 64 2e-10 XP_017406349.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-09 XP_004145279.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-09 XP_014493356.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 8e-09 XP_008457435.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-08 XP_004291520.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-08 XP_015952210.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-08 XP_010106566.1 hypothetical protein L484_025326 [Morus notabilis... 56 1e-07 XP_016187211.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 2e-07 XP_008386010.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 8e-07 XP_012066943.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 1e-06 XP_018830524.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 4e-06 KDP42187.1 hypothetical protein JCGZ_02917 [Jatropha curcas] 52 4e-06 >XP_004507153.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cicer arietinum] Length = 261 Score = 95.9 bits (237), Expect = 1e-22 Identities = 49/76 (64%), Positives = 55/76 (72%), Gaps = 5/76 (6%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVS--TRSSKPIRDASTPLMPSRP---FQCRRLWGFRE 170 MASRCFM+KWE RLASV+L E S TR S IRD ST L + F+ + +WGFRE Sbjct: 1 MASRCFMRKWETCRLASVFLTELTSNSTRCSNLIRDVSTALSSTHSIAMFEPKSVWGFRE 60 Query: 171 YHDGRPRGPLWRGKKL 218 YHDGRPRGPLWRGKKL Sbjct: 61 YHDGRPRGPLWRGKKL 76 >XP_013456164.1 PPR containing plant-like protein [Medicago truncatula] KEH30195.1 PPR containing plant-like protein [Medicago truncatula] Length = 261 Score = 81.6 bits (200), Expect = 4e-17 Identities = 40/76 (52%), Positives = 52/76 (68%), Gaps = 5/76 (6%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVS--TRSSKPIRDASTPLMPSR---PFQCRRLWGFRE 170 MA RC ++KW+ RL S +L +F S T++ PIRD S+ L + F+ + + GFRE Sbjct: 1 MALRCILRKWKTHRLTSSFLTQFTSNPTKTINPIRDISSALSSTHFITSFEHKNVTGFRE 60 Query: 171 YHDGRPRGPLWRGKKL 218 YHDGRPRGPLWRGKKL Sbjct: 61 YHDGRPRGPLWRGKKL 76 >XP_003537970.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Glycine max] KRH29734.1 hypothetical protein GLYMA_11G135100 [Glycine max] Length = 255 Score = 76.3 bits (186), Expect = 4e-15 Identities = 40/72 (55%), Positives = 49/72 (68%), Gaps = 1/72 (1%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQC-RRLWGFREYHDG 182 MASR F+K W+I AS+ LGEF TRS KPI+D S+ + F + FR+YHDG Sbjct: 1 MASRSFLKNWKILDFASLLLGEF--TRSIKPIKDVSSTSLTFVEFNSFKTALCFRQYHDG 58 Query: 183 RPRGPLWRGKKL 218 RPRGPLW+GKKL Sbjct: 59 RPRGPLWKGKKL 70 >XP_019454098.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Lupinus angustifolius] XP_019454099.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Lupinus angustifolius] OIW05740.1 hypothetical protein TanjilG_23526 [Lupinus angustifolius] Length = 254 Score = 74.3 bits (181), Expect = 2e-14 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRL-WGFREYHDG 182 MA+R F KKW L S +L + TR+ PI+ +S+ FQC+ + WG REYHDG Sbjct: 1 MATRSFFKKWRFPHLVSPFLNQL--TRTPNPIKQSSST-SDVAVFQCKTVSWGLREYHDG 57 Query: 183 RPRGPLWRGKKL 218 RPRGPLW+GKKL Sbjct: 58 RPRGPLWKGKKL 69 >KYP37127.1 Pentatricopeptide repeat-containing protein At3g46870 family [Cajanus cajan] Length = 257 Score = 72.0 bits (175), Expect = 2e-13 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDAST--PLMP-SRPFQCRRLWGFREYH 176 MA R F K++IR L SV +GEF TRS KPI+DAST PL+ S + R YH Sbjct: 1 MAFRSFSNKFKIRDLGSVIVGEF--TRSRKPIKDASTSMPLVAVSESNWFKTASWLRHYH 58 Query: 177 DGRPRGPLWRGKKL 218 DGRPRGPLWRGKKL Sbjct: 59 DGRPRGPLWRGKKL 72 >XP_006591821.1 PREDICTED: uncharacterized protein LOC100306428 isoform X1 [Glycine max] KHN25233.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH24725.1 hypothetical protein GLYMA_12G058700 [Glycine max] KRH24726.1 hypothetical protein GLYMA_12G058700 [Glycine max] KRH24727.1 hypothetical protein GLYMA_12G058700 [Glycine max] Length = 255 Score = 68.9 bits (167), Expect = 2e-12 Identities = 40/74 (54%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIR---DASTPLMPSRPFQCRRLWGFREYH 176 MASR F K + R LAS+ L EF TRSSKPI+ S+P + F+ FR+YH Sbjct: 1 MASRSFFKNLKNRDLASLLLVEF--TRSSKPIKHISSTSSPFVECNSFKTASC--FRQYH 56 Query: 177 DGRPRGPLWRGKKL 218 DGRPRGPLW+GKKL Sbjct: 57 DGRPRGPLWKGKKL 70 >GAU45009.1 hypothetical protein TSUD_88000 [Trifolium subterraneum] Length = 261 Score = 66.2 bits (160), Expect = 2e-11 Identities = 37/78 (47%), Positives = 45/78 (57%), Gaps = 7/78 (8%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRLW-------GF 164 MA RC M+KWE R AS++L +T IRD + + R ++ GF Sbjct: 1 MAIRCLMRKWETCRKASIFLTS--NTTPLTIIRDNISSALSLRHIVASSVFEYKNVCVGF 58 Query: 165 REYHDGRPRGPLWRGKKL 218 REYHDGRPRGPLWRGKKL Sbjct: 59 REYHDGRPRGPLWRGKKL 76 >XP_007132030.1 hypothetical protein PHAVU_011G060800g [Phaseolus vulgaris] ESW04024.1 hypothetical protein PHAVU_011G060800g [Phaseolus vulgaris] Length = 254 Score = 63.5 bits (153), Expect = 2e-10 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPL--MPSRPFQCRRLWGFREYHD 179 MA R F K W+I S+ + F TR++K I+ AS PL + S F+ W R YHD Sbjct: 1 MAGRSFSKVWKICDFGSLLVPHF--TRTTKLIKHASPPLSFLQSNSFKTPSFW--RLYHD 56 Query: 180 GRPRGPLWRGKKL 218 GRPRGPLW+GKKL Sbjct: 57 GRPRGPLWKGKKL 69 >XP_017406349.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vigna angularis] XP_017406350.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vigna angularis] KOM26232.1 hypothetical protein LR48_Vigan238s006500 [Vigna angularis] BAT90758.1 hypothetical protein VIGAN_06204100 [Vigna angularis var. angularis] Length = 254 Score = 61.6 bits (148), Expect = 1e-09 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPL--MPSRPFQCRRLWGFREYHD 179 MASR F K +I S+ +G+ TR++K I S PL + S F+ W R+YHD Sbjct: 1 MASRSFSKVRKICDFGSLLVGQL--TRATKLIEHGSAPLPFVESTSFKTASCW--RQYHD 56 Query: 180 GRPRGPLWRGKKL 218 GRPRGPLWRGKKL Sbjct: 57 GRPRGPLWRGKKL 69 >XP_004145279.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cucumis sativus] KGN65758.1 hypothetical protein Csa_1G525290 [Cucumis sativus] Length = 255 Score = 60.5 bits (145), Expect = 3e-09 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 4/66 (6%) Frame = +3 Query: 30 KWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS----RPFQCRRLWGFREYHDGRPRGP 197 +W R V+ F+ + +PIRD P+ + +P R +WGFR YHDGRPRGP Sbjct: 4 RWFSRSKLPVFASVFLQGLTRRPIRDVPLPVKSTITDFQPDSRRPIWGFRLYHDGRPRGP 63 Query: 198 LWRGKK 215 LWR +K Sbjct: 64 LWRSRK 69 >XP_014493356.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vigna radiata var. radiata] Length = 254 Score = 59.3 bits (142), Expect = 8e-09 Identities = 35/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPL--MPSRPFQCRRLWGFREYHD 179 MASR F K +I S+ +G+ TR++K I S PL + S + W R+YHD Sbjct: 1 MASRSFSKVRKICDFGSLLVGQL--TRATKLIEHCSAPLPFVESTSLKTASCW--RQYHD 56 Query: 180 GRPRGPLWRGKKL 218 GRPRGPLWRGKKL Sbjct: 57 GRPRGPLWRGKKL 69 >XP_008457435.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Cucumis melo] Length = 255 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 4/66 (6%) Frame = +3 Query: 30 KWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS----RPFQCRRLWGFREYHDGRPRGP 197 +W R ++ F+ + +PIRD P+ + +P R +WGFR YHDGRPRGP Sbjct: 4 RWFSRSKLPIFALVFLRGLTRRPIRDVPLPVTSTITGFQPDSSRPIWGFRLYHDGRPRGP 63 Query: 198 LWRGKK 215 LWR +K Sbjct: 64 LWRSRK 69 >XP_004291520.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Fragaria vesca subsp. vesca] Length = 255 Score = 57.0 bits (136), Expect = 6e-08 Identities = 27/45 (60%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = +3 Query: 96 PIRDASTPLMPSRPFQ----CRRLWGFREYHDGRPRGPLWRGKKL 218 PIR+ P PS P C+ + GFR YHDGRPRGPLWRGKKL Sbjct: 26 PIRENPFPPKPSSPVSQIQSCQPICGFRLYHDGRPRGPLWRGKKL 70 >XP_015952210.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Arachis duranensis] XP_015952212.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Arachis duranensis] Length = 259 Score = 57.0 bits (136), Expect = 6e-08 Identities = 34/74 (45%), Positives = 43/74 (58%), Gaps = 3/74 (4%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS--RPFQCRRLWG-FREYH 176 MASR RL+SV+L F +T ++ +S+ L+P R F + FR YH Sbjct: 1 MASRRCFTMLRRARLSSVFLRHFTTTPNTITHHSSSSLLLPPLLRVFDSAKTASCFRHYH 60 Query: 177 DGRPRGPLWRGKKL 218 DGRPRGPLWRGKKL Sbjct: 61 DGRPRGPLWRGKKL 74 >XP_010106566.1 hypothetical protein L484_025326 [Morus notabilis] EXC10742.1 hypothetical protein L484_025326 [Morus notabilis] Length = 324 Score = 56.2 bits (134), Expect = 1e-07 Identities = 37/75 (49%), Positives = 43/75 (57%), Gaps = 4/75 (5%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS-RPFQC---RRLWGFREY 173 MASR F + +I LAS T PI+D+ PL F+ R + GFREY Sbjct: 1 MASRAFSRS-KISILASGLFRAIYRT----PIKDSPLPLKSKVSAFETDPWRPVCGFREY 55 Query: 174 HDGRPRGPLWRGKKL 218 HDGRPRGPLWRGKKL Sbjct: 56 HDGRPRGPLWRGKKL 70 >XP_016187211.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Arachis ipaensis] XP_016187212.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Arachis ipaensis] XP_016187213.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Arachis ipaensis] Length = 258 Score = 55.8 bits (133), Expect = 2e-07 Identities = 35/73 (47%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPS-RPFQCRRLWG-FREYHD 179 MASR RLASV+L F +T ++ +S L P R F + FR YHD Sbjct: 1 MASRRCFTMLRRARLASVFLRHFTTTPNTITHHSSSLLLPPLLRVFDSAKTASCFRHYHD 60 Query: 180 GRPRGPLWRGKKL 218 GRPRGPLWRGKKL Sbjct: 61 GRPRGPLWRGKKL 73 >XP_008386010.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Malus domestica] XP_008386011.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Malus domestica] Length = 256 Score = 53.9 bits (128), Expect = 8e-07 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 6/77 (7%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPF------QCRRLWGFR 167 MA+R F R +S + + + PI+ +TPL+ + CR + GFR Sbjct: 1 MATRAFS-----RSKSSFFSSVLLQNLKTTPIK--TTPLLLNSTIPELEIKSCRPISGFR 53 Query: 168 EYHDGRPRGPLWRGKKL 218 YHDGRPRGPLWRGKKL Sbjct: 54 LYHDGRPRGPLWRGKKL 70 >XP_012066943.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Jatropha curcas] XP_012066944.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Jatropha curcas] Length = 269 Score = 53.5 bits (127), Expect = 1e-06 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 6/78 (7%) Frame = +3 Query: 3 VMASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRLW------GF 164 VMA R F + +I +L++V+L ++ KP S P P + + G Sbjct: 12 VMAVRAFSRS-KIAKLSAVFL----QNQTVKPTIPISLPSKPQISYSDSNILSYSYFCGL 66 Query: 165 REYHDGRPRGPLWRGKKL 218 R+YHDGRPRGPLWRGKKL Sbjct: 67 RQYHDGRPRGPLWRGKKL 84 >XP_018830524.1 PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Juglans regia] Length = 252 Score = 52.0 bits (123), Expect = 4e-06 Identities = 27/45 (60%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = +3 Query: 96 PIRDASTPLMP----SRPFQCRRLWGFREYHDGRPRGPLWRGKKL 218 PIR+ S P+ P S P C+ FR YHDGRPRGPLWRGKKL Sbjct: 26 PIREPSLPVKPEVLASVPDYCKP---FRLYHDGRPRGPLWRGKKL 67 >KDP42187.1 hypothetical protein JCGZ_02917 [Jatropha curcas] Length = 257 Score = 52.0 bits (123), Expect = 4e-06 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 6/77 (7%) Frame = +3 Query: 6 MASRCFMKKWEIRRLASVYLGEFVSTRSSKPIRDASTPLMPSRPFQCRRLW------GFR 167 MA R F + +I +L++V+L ++ KP S P P + + G R Sbjct: 1 MAVRAFSRS-KIAKLSAVFL----QNQTVKPTIPISLPSKPQISYSDSNILSYSYFCGLR 55 Query: 168 EYHDGRPRGPLWRGKKL 218 +YHDGRPRGPLWRGKKL Sbjct: 56 QYHDGRPRGPLWRGKKL 72