BLASTX nr result
ID: Glycyrrhiza28_contig00034253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034253 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEB35977.1 ATML1, partial [Helianthus petiolaris] 55 2e-06 ACU17291.1 unknown, partial [Glycine max] 53 6e-06 >AEB35977.1 ATML1, partial [Helianthus petiolaris] Length = 149 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 466 IVLSAATSFLLPVSPKRVFEFLCDENSKSE 377 IVLSAATSF +PV PKRVF+FLCDENS+SE Sbjct: 120 IVLSAATSFWIPVQPKRVFDFLCDENSRSE 149 >ACU17291.1 unknown, partial [Glycine max] Length = 129 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 378 SLLEFSSQRNSNTLFGDTGSKKDVAALRTI 467 SLLEFSS+RNS TLFGDTGS+K+VAALRT+ Sbjct: 42 SLLEFSSRRNSKTLFGDTGSQKEVAALRTL 71