BLASTX nr result
ID: Glycyrrhiza28_contig00034080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034080 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003617536.1 hypothetical protein MTR_5g092690 [Medicago trunc... 96 1e-22 >XP_003617536.1 hypothetical protein MTR_5g092690 [Medicago truncatula] AET00495.1 hypothetical protein MTR_5g092690 [Medicago truncatula] Length = 127 Score = 95.5 bits (236), Expect = 1e-22 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +2 Query: 221 GCQWELHGVHCKGPKASKAHEFLNEFNAIERVREAGSSPTRCSVNI 358 GCQWELHGVHCKG KASKAH+F+NEFNAIERVREAGSSPTRCSV++ Sbjct: 32 GCQWELHGVHCKGQKASKAHDFINEFNAIERVREAGSSPTRCSVSV 77