BLASTX nr result
ID: Glycyrrhiza28_contig00034073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034073 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024584798.1 MULTISPECIES: membrane protein [Bradyrhizobium] K... 86 3e-19 WP_076865090.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 85 4e-19 WP_029077534.1 membrane protein [Bradyrhizobium sp. th.b2] 85 4e-19 ERF82491.1 thioredoxin reductase (NADPH) [Bradyrhizobium sp. DFC... 85 4e-19 SED98002.1 Uncharacterized conserved protein, MAPEG superfamily ... 84 1e-18 WP_066508405.1 hypothetical protein [Bradyrhizobium sp. BR 10303... 83 2e-18 WP_044589782.1 membrane protein [Bradyrhizobium sp. LTSPM299] KJ... 83 2e-18 WP_044543144.1 membrane protein [Bradyrhizobium sp. LTSP885] KJC... 83 2e-18 WP_074130045.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 83 3e-18 WP_050405789.1 hypothetical protein [Bradyrhizobium embrapense] 83 3e-18 WP_028332868.1 membrane protein [Bradyrhizobium elkanii] 83 3e-18 WP_016842609.1 MULTISPECIES: membrane protein [Bradyrhizobium] K... 83 3e-18 WP_065751858.1 hypothetical protein [Bradyrhizobium paxllaeri] O... 82 4e-18 WP_057861007.1 hypothetical protein [Bradyrhizobium lablabi] KRR... 82 4e-18 WP_050385221.1 hypothetical protein [Bradyrhizobium pachyrhizi] 82 9e-18 WP_074270871.1 hypothetical protein [Bradyrhizobium erythrophlei... 81 1e-17 WP_050630610.1 hypothetical protein [Bradyrhizobium viridifuturi] 81 1e-17 WP_027539860.1 membrane protein [Bradyrhizobium sp. URHA0002] 81 1e-17 WP_057838975.1 hypothetical protein [Bradyrhizobium jicamae] KRQ... 80 3e-17 WP_028350473.1 membrane protein [Bradyrhizobium elkanii] 80 4e-17 >WP_024584798.1 MULTISPECIES: membrane protein [Bradyrhizobium] KIU51267.1 membrane protein [Bradyrhizobium elkanii] OCX28190.1 hypothetical protein QU42_24205 [Bradyrhizobium sp. UASWS1016] Length = 132 Score = 85.5 bits (210), Expect = 3e-19 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTYVG+RPTLRSILWSIGFAINIAIFFLPAIRGYL+S Sbjct: 90 VRIAYVFTYVGNRPTLRSILWSIGFAINIAIFFLPAIRGYLTS 132 >WP_076865090.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 132 Score = 85.1 bits (209), Expect = 4e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYLTS 132 >WP_029077534.1 membrane protein [Bradyrhizobium sp. th.b2] Length = 132 Score = 85.1 bits (209), Expect = 4e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYLTS 132 >ERF82491.1 thioredoxin reductase (NADPH) [Bradyrhizobium sp. DFCI-1] Length = 132 Score = 85.1 bits (209), Expect = 4e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYLTS 132 >SED98002.1 Uncharacterized conserved protein, MAPEG superfamily [Bradyrhizobium erythrophlei] Length = 132 Score = 84.0 bits (206), Expect = 1e-18 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL++ Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYLTN 132 >WP_066508405.1 hypothetical protein [Bradyrhizobium sp. BR 10303] KWV54038.1 hypothetical protein AS156_07295 [Bradyrhizobium sp. BR 10303] Length = 132 Score = 83.2 bits (204), Expect = 2e-18 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLS 126 VR+AYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL+ Sbjct: 90 VRVAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYLT 131 >WP_044589782.1 membrane protein [Bradyrhizobium sp. LTSPM299] KJC58160.1 membrane protein [Bradyrhizobium sp. LTSPM299] Length = 132 Score = 83.2 bits (204), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYL 130 >WP_044543144.1 membrane protein [Bradyrhizobium sp. LTSP885] KJC33838.1 membrane protein [Bradyrhizobium sp. LTSP885] Length = 132 Score = 83.2 bits (204), Expect = 2e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAIRGYL Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFFLPAIRGYL 130 >WP_074130045.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO71848.1 membrane protein [Bradyrhizobium sp. NAS96.2] Length = 132 Score = 82.8 bits (203), Expect = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIF LPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFLLPAIRGYLTS 132 >WP_050405789.1 hypothetical protein [Bradyrhizobium embrapense] Length = 132 Score = 82.8 bits (203), Expect = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIF LPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFLLPAIRGYLTS 132 >WP_028332868.1 membrane protein [Bradyrhizobium elkanii] Length = 132 Score = 82.8 bits (203), Expect = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIF LPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFLLPAIRGYLTS 132 >WP_016842609.1 MULTISPECIES: membrane protein [Bradyrhizobium] KRQ10514.1 hypothetical protein AOQ73_08655 [Bradyrhizobium pachyrhizi] ODM71993.1 hypothetical protein A6452_07200 [Bradyrhizobium elkanii] ODM84891.1 hypothetical protein A6X20_13290 [Bradyrhizobium elkanii] SDE79141.1 Uncharacterized conserved protein, MAPEG superfamily [Bradyrhizobium sp. R5] OIM88819.1 hypothetical protein BLN97_43220 [Bradyrhizobium elkanii] OMI10292.1 hypothetical protein BSN85_15870 [Bradyrhizobium sp. UFLA 03-321] Length = 132 Score = 82.8 bits (203), Expect = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIF LPAIRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFLLPAIRGYLTS 132 >WP_065751858.1 hypothetical protein [Bradyrhizobium paxllaeri] OCK65356.1 hypothetical protein LMTR21_31975 [Bradyrhizobium paxllaeri] Length = 132 Score = 82.4 bits (202), Expect = 4e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+GDRPTLRSILWS+GFAINIAIFFLPAI+GYL Sbjct: 90 VRIAYVFTYLGDRPTLRSILWSLGFAINIAIFFLPAIKGYL 130 >WP_057861007.1 hypothetical protein [Bradyrhizobium lablabi] KRR19593.1 hypothetical protein CQ14_17430 [Bradyrhizobium lablabi] Length = 132 Score = 82.4 bits (202), Expect = 4e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+GDRPTLRSILWS+GFAINIAIFFLPAI+GYL Sbjct: 90 VRIAYVFTYLGDRPTLRSILWSLGFAINIAIFFLPAIKGYL 130 >WP_050385221.1 hypothetical protein [Bradyrhizobium pachyrhizi] Length = 132 Score = 81.6 bits (200), Expect = 9e-18 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLSS 129 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIF LP+IRGYL+S Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFLLPSIRGYLTS 132 >WP_074270871.1 hypothetical protein [Bradyrhizobium erythrophlei] SIN84235.1 Uncharacterized conserved protein, MAPEG superfamily [Bradyrhizobium erythrophlei] Length = 132 Score = 81.3 bits (199), Expect = 1e-17 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+G+RPTLRSILWS+GFAINIAIFFLPA+RGYL Sbjct: 90 VRIAYVFTYLGNRPTLRSILWSLGFAINIAIFFLPAVRGYL 130 >WP_050630610.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 132 Score = 81.3 bits (199), Expect = 1e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLS 126 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIF LPAIRGYL+ Sbjct: 90 VRIAYVFTYIGNRPTLRSILWSIGFAINIAIFLLPAIRGYLT 131 >WP_027539860.1 membrane protein [Bradyrhizobium sp. URHA0002] Length = 132 Score = 81.3 bits (199), Expect = 1e-17 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+GDRP+LRSILWSIGFAIN+AIFFLPAI+GYL Sbjct: 90 VRIAYVFTYLGDRPSLRSILWSIGFAINVAIFFLPAIKGYL 130 >WP_057838975.1 hypothetical protein [Bradyrhizobium jicamae] KRQ98917.1 hypothetical protein CQ12_23810 [Bradyrhizobium jicamae] Length = 132 Score = 80.5 bits (197), Expect = 3e-17 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYL 123 VRIAYVFTY+G+RPTLRSILWS+GFAINIAIFFLPAI+GYL Sbjct: 90 VRIAYVFTYLGNRPTLRSILWSLGFAINIAIFFLPAIKGYL 130 >WP_028350473.1 membrane protein [Bradyrhizobium elkanii] Length = 132 Score = 80.1 bits (196), Expect = 4e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 1 VRIAYVFTYVGDRPTLRSILWSIGFAINIAIFFLPAIRGYLS 126 VRIAYVFTY+G+RPTLRSILWSIGFAINIAIFFLPAI+ YLS Sbjct: 90 VRIAYVFTYLGNRPTLRSILWSIGFAINIAIFFLPAIKDYLS 131